BLASTX nr result
ID: Rehmannia27_contig00000309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00000309 (358 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090847.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 94 2e-20 gb|EYU29828.1| hypothetical protein MIMGU_mgv1a016414mg [Erythra... 86 1e-19 ref|XP_012858769.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 86 1e-17 ref|XP_009596740.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 54 5e-06 >ref|XP_011090847.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Sesamum indicum] Length = 420 Score = 94.0 bits (232), Expect = 2e-20 Identities = 47/65 (72%), Positives = 54/65 (83%) Frame = +3 Query: 162 MSICTPFNCNGLTLQSSKSHSIKRVFTSHLITKFQVTTVPYAIPLPSVYLSEPIKFSAKR 341 MSI TPF+ NGLT QSSKS S KR F+ HLI++ QVTTVPYAIPLPSVYLS+P +FS +R Sbjct: 1 MSISTPFSSNGLTYQSSKSRSFKRHFSYHLISQVQVTTVPYAIPLPSVYLSKPKRFSKER 60 Query: 342 FNLVT 356 F LVT Sbjct: 61 FKLVT 65 >gb|EYU29828.1| hypothetical protein MIMGU_mgv1a016414mg [Erythranthe guttata] Length = 123 Score = 86.3 bits (212), Expect = 1e-19 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 162 MSICTPFNCNGLTLQSSKSHSIKRVFTSHLITKFQVTTVPYAIPLPSVYLSEPIKFSAKR 341 MS CTP N NG TLQ SK S K + SHLI++FQVTT PYAIPLPS++L +P KF K+ Sbjct: 1 MSACTPLNGNGFTLQPSKRRSFKGLHASHLISQFQVTTAPYAIPLPSLHLHQPSKFRPKK 60 Query: 342 FNLVT 356 FNL T Sbjct: 61 FNLFT 65 >ref|XP_012858769.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Erythranthe guttata] gi|604345315|gb|EYU43897.1| hypothetical protein MIMGU_mgv1a018558mg [Erythranthe guttata] Length = 416 Score = 86.3 bits (212), Expect = 1e-17 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 162 MSICTPFNCNGLTLQSSKSHSIKRVFTSHLITKFQVTTVPYAIPLPSVYLSEPIKFSAKR 341 MS CTP N NG TLQ SK S K + SHLI++FQVTT PYAIPLPS++L +P KF K+ Sbjct: 1 MSACTPLNGNGFTLQPSKRRSFKGLHASHLISQFQVTTAPYAIPLPSLHLHQPSKFRPKK 60 Query: 342 FNLVT 356 FNL T Sbjct: 61 FNLFT 65 >ref|XP_009596740.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Nicotiana tomentosiformis] gi|697175599|ref|XP_009596741.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Nicotiana tomentosiformis] Length = 416 Score = 53.5 bits (127), Expect = 5e-06 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = +3 Query: 162 MSICTPFNCNGLTLQSSKSHSIKRVFTSHLITKFQVTTVPYAIPLPSVYLSEPIKFSAKR 341 MS PF+ GLTLQS+K H+ +++ +SH I QV+TVPYAIP SV + P + ++++ Sbjct: 1 MSAFAPFS--GLTLQSTKDHNFRQLLSSHFINHVQVSTVPYAIPFLSV--NVPFRVNSRK 56 Query: 342 FNLVT 356 +T Sbjct: 57 LKPIT 61