BLASTX nr result
ID: Rehmannia27_contig00000131
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00000131 (867 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX89589.1| Lhca3 [Solanum tuberosum] gi|162423648|gb|ABX8959... 78 2e-15 gb|ABN48563.1| chloroplast PSI type III chlorophyll a/b-binding ... 80 2e-15 ref|XP_006431740.1| hypothetical protein CICLE_v10002129mg [Citr... 80 7e-15 dbj|BAD06999.1| chlorophyll a/b-binding protein-like protein [Ip... 77 7e-15 gb|AAR85970.1| type III chlorophyll a/b-binding protein [Nicotia... 77 9e-15 ref|NP_001148598.1| chlorophyll a-b binding protein 8 [Zea mays]... 79 1e-14 ref|NP_001031217.1| PSI type III chlorophyll a/b-binding protein... 80 1e-14 ref|XP_006431741.1| hypothetical protein CICLE_v10002129mg [Citr... 80 2e-14 gb|AAS56914.1| CAB-like protein [Ipomoea nil] 77 2e-14 gb|KVI08742.1| hypothetical protein Ccrd_012865 [Cynara carduncu... 80 4e-14 gb|KFK40697.1| hypothetical protein AALP_AA2G029600 [Arabis alpina] 80 4e-14 gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Ara... 80 4e-14 ref|XP_010692543.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-14 ref|XP_010473361.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-14 ref|XP_010418122.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-14 ref|XP_009778440.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-14 ref|NP_176347.1| PSI type III chlorophyll a/b-binding protein [A... 80 4e-14 ref|XP_006350000.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-14 ref|XP_006302674.1| hypothetical protein CARUB_v10020781mg [Caps... 80 4e-14 ref|XP_002888084.1| hypothetical protein ARALYDRAFT_475174 [Arab... 80 4e-14 >gb|ABX89589.1| Lhca3 [Solanum tuberosum] gi|162423648|gb|ABX89590.1| Lhca3 [Solanum tuberosum] Length = 45 Score = 78.2 bits (191), Expect = 2e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQ LVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 9 LGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 45 >gb|ABN48563.1| chloroplast PSI type III chlorophyll a/b-binding protein [Brassica juncea] Length = 110 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYF+QGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 74 LGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 110 >ref|XP_006431740.1| hypothetical protein CICLE_v10002129mg [Citrus clementina] gi|557533862|gb|ESR44980.1| hypothetical protein CICLE_v10002129mg [Citrus clementina] gi|641824204|gb|KDO43554.1| hypothetical protein CISIN_1g023899mg [Citrus sinensis] Length = 166 Score = 80.1 bits (196), Expect = 7e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYF+QGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 130 LGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 166 >dbj|BAD06999.1| chlorophyll a/b-binding protein-like protein [Ipomoea nil] Length = 51 Score = 76.6 bits (187), Expect = 7e-15 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQ LVTGVGPYQNLLDHLADPVNNN+LT+LKFH Sbjct: 15 LGYFIQALVTGVGPYQNLLDHLADPVNNNILTNLKFH 51 >gb|AAR85970.1| type III chlorophyll a/b-binding protein [Nicotiana tabacum] Length = 85 Score = 77.4 bits (189), Expect = 9e-15 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNN+LT+ KFH Sbjct: 49 LGYFIQGLVTGVGPYQNLLDHLADPVNNNILTNFKFH 85 >ref|NP_001148598.1| chlorophyll a-b binding protein 8 [Zea mays] gi|195620680|gb|ACG32170.1| chlorophyll a-b binding protein 8 [Zea mays] Length = 151 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 115 LGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 151 >ref|NP_001031217.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332195726|gb|AEE33847.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 218 Score = 80.5 bits (197), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 182 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 218 >ref|XP_006431741.1| hypothetical protein CICLE_v10002129mg [Citrus clementina] gi|557533863|gb|ESR44981.1| hypothetical protein CICLE_v10002129mg [Citrus clementina] gi|641824203|gb|KDO43553.1| hypothetical protein CISIN_1g023899mg [Citrus sinensis] Length = 211 Score = 80.1 bits (196), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYF+QGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 175 LGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 211 >gb|AAS56914.1| CAB-like protein [Ipomoea nil] Length = 96 Score = 76.6 bits (187), Expect = 2e-14 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQ LVTGVGPYQNLLDHLADPVNNN+LT+LKFH Sbjct: 60 LGYFIQALVTGVGPYQNLLDHLADPVNNNILTNLKFH 96 >gb|KVI08742.1| hypothetical protein Ccrd_012865 [Cynara cardunculus var. scolymus] Length = 271 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 235 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 271 >gb|KFK40697.1| hypothetical protein AALP_AA2G029600 [Arabis alpina] Length = 271 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 235 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 271 >gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_010692543.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870847361|gb|KMS99733.1| hypothetical protein BVRB_1g021010 [Beta vulgaris subsp. vulgaris] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_010473361.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Camelina sativa] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_010418122.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic [Camelina sativa] gi|727508086|ref|XP_010430161.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic [Camelina sativa] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_009778440.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Nicotiana sylvestris] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|NP_176347.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|334183551|ref|NP_001185280.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|75266695|sp|Q9SY97.1|LHCA3_ARATH RecName: Full=Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic; Short=Lhca3*1; AltName: Full=LHCI type III LHCA3; Flags: Precursor gi|4585882|gb|AAD25555.1|AC005850_12 PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|16649019|gb|AAL24361.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|20260044|gb|AAM13369.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332195725|gb|AEE33846.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332195727|gb|AEE33848.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_006350000.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Solanum tuberosum] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_006302674.1| hypothetical protein CARUB_v10020781mg [Capsella rubella] gi|482571384|gb|EOA35572.1| hypothetical protein CARUB_v10020781mg [Capsella rubella] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_002888084.1| hypothetical protein ARALYDRAFT_475174 [Arabidopsis lyrata subsp. lyrata] gi|297333925|gb|EFH64343.1| hypothetical protein ARALYDRAFT_475174 [Arabidopsis lyrata subsp. lyrata] Length = 273 Score = 80.5 bits (197), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 867 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 757 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH Sbjct: 237 LGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273