BLASTX nr result
ID: Rehmannia26_contig00034735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00034735 (548 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83990.1| hypothetical protein VITISV_018454 [Vitis vinifera] 57 3e-06 >emb|CAN83990.1| hypothetical protein VITISV_018454 [Vitis vinifera] Length = 1243 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +1 Query: 1 DKYRAGLIKPLHVRSSCQLADILTNALSPGLFRAIVVKMGLRNIFLPS 144 DK ++G++KPL V + QLAD+LT AL P F+ ++ KMGL+NIF PS Sbjct: 1196 DKVQSGVLKPLFVSTEHQLADVLTKALHPSSFKLLIGKMGLKNIFSPS 1243