BLASTX nr result
ID: Rehmannia26_contig00034461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00034461 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB53805.1| hypothetical protein L484_006294 [Morus notabilis] 56 6e-06 >gb|EXB53805.1| hypothetical protein L484_006294 [Morus notabilis] Length = 118 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = +2 Query: 2 RRPSWLRVKMLKLKTKFGKRLKNLKKGFSSTVFSAKADLCKQITCVLKSCKHL 160 RRPS+LR+++ KLK K GKRL L+K ++ +AK +CKQ+ K+C+ L Sbjct: 44 RRPSYLRIRIRKLKVKIGKRLTKLRKSMLLSISAAKVSVCKQVCSQFKTCRRL 96