BLASTX nr result
ID: Rehmannia26_contig00034017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00034017 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY14338.1| NAC domain transcriptional regulator superfamily ... 78 1e-12 ref|XP_002316163.2| no apical meristem family protein [Populus t... 77 2e-12 ref|XP_006493793.1| PREDICTED: protein SOMBRERO-like [Citrus sin... 77 3e-12 ref|XP_006422353.1| hypothetical protein CICLE_v10006623mg [Citr... 77 3e-12 ref|XP_002521498.1| NAC domain-containing protein, putative [Ric... 76 5e-12 ref|XP_004295539.1| PREDICTED: protein SOMBRERO-like [Fragaria v... 75 7e-12 ref|XP_002311276.1| no apical meristem family protein [Populus t... 75 7e-12 gb|EXB62695.1| Protein SOMBRERO [Morus notabilis] 75 1e-11 gb|ESW21134.1| hypothetical protein PHAVU_005G044600g [Phaseolus... 74 2e-11 gb|EOY14339.1| NAC domain transcriptional regulator superfamily ... 74 2e-11 ref|XP_003531470.1| PREDICTED: protein SOMBRERO-like [Glycine max] 74 2e-11 gb|EMJ14643.1| hypothetical protein PRUPE_ppa025341mg [Prunus pe... 74 3e-11 ref|XP_006598233.1| PREDICTED: protein SOMBRERO-like [Glycine max] 74 3e-11 ref|XP_003595868.1| NAC domain-containing protein [Medicago trun... 73 3e-11 gb|AGL39670.1| NAC transcription factor 014 [Jatropha curcas] 73 4e-11 ref|XP_004488594.1| PREDICTED: protein SOMBRERO-like [Cicer arie... 72 8e-11 gb|AFW76569.1| putative NAC domain transcription factor superfam... 72 8e-11 gb|ACF83821.1| unknown [Zea mays] gi|195659457|gb|ACG49196.1| NA... 72 8e-11 emb|CAH56055.1| hypothetical protein [Zea mays] 72 8e-11 ref|XP_006389872.1| hypothetical protein EUTSA_v10019534mg [Eutr... 72 1e-10 >gb|EOY14338.1| NAC domain transcriptional regulator superfamily protein isoform 1 [Theobroma cacao] Length = 334 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 207 ENMMMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 EN M+ GNG++SVPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 16 ENKMLPGNGQLSVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 57 >ref|XP_002316163.2| no apical meristem family protein [Populus trichocarpa] gi|550330082|gb|EEF02334.2| no apical meristem family protein [Populus trichocarpa] Length = 319 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MMAGNG++SVPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMAGNGQLSVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >ref|XP_006493793.1| PREDICTED: protein SOMBRERO-like [Citrus sinensis] Length = 370 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MMAGNGE+SVPPGFRFHPTDEELLYYYLRKKVS+E I L Sbjct: 1 MMAGNGELSVPPGFRFHPTDEELLYYYLRKKVSFEAIDL 39 >ref|XP_006422353.1| hypothetical protein CICLE_v10006623mg [Citrus clementina] gi|557524226|gb|ESR35593.1| hypothetical protein CICLE_v10006623mg [Citrus clementina] Length = 372 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MMAGNGE+SVPPGFRFHPTDEELLYYYLRKKVS+E I L Sbjct: 1 MMAGNGELSVPPGFRFHPTDEELLYYYLRKKVSFEAIDL 39 >ref|XP_002521498.1| NAC domain-containing protein, putative [Ricinus communis] gi|223539295|gb|EEF40887.1| NAC domain-containing protein, putative [Ricinus communis] Length = 314 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MMAGNG++SVPPGFRFHPTDEELLYYYL+KKVSYE I L Sbjct: 1 MMAGNGQLSVPPGFRFHPTDEELLYYYLKKKVSYEAIDL 39 >ref|XP_004295539.1| PREDICTED: protein SOMBRERO-like [Fragaria vesca subsp. vesca] Length = 358 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 213 MMMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM AGNG+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMSAGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 40 >ref|XP_002311276.1| no apical meristem family protein [Populus trichocarpa] gi|222851096|gb|EEE88643.1| no apical meristem family protein [Populus trichocarpa] Length = 319 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM GNG++SVPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMTGNGQLSVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|EXB62695.1| Protein SOMBRERO [Morus notabilis] Length = 342 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M AGNG++SVPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MAAGNGQLSVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|ESW21134.1| hypothetical protein PHAVU_005G044600g [Phaseolus vulgaris] Length = 324 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM GNG+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMPGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|EOY14339.1| NAC domain transcriptional regulator superfamily protein isoform 2 [Theobroma cacao] gi|508722443|gb|EOY14340.1| NAC domain transcriptional regulator superfamily protein isoform 2 [Theobroma cacao] Length = 316 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M+ GNG++SVPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MLPGNGQLSVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >ref|XP_003531470.1| PREDICTED: protein SOMBRERO-like [Glycine max] Length = 328 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM GNG+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMPGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|EMJ14643.1| hypothetical protein PRUPE_ppa025341mg [Prunus persica] Length = 361 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M AGNG+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MAAGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >ref|XP_006598233.1| PREDICTED: protein SOMBRERO-like [Glycine max] Length = 326 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM GNG+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMPGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEVIDL 39 >ref|XP_003595868.1| NAC domain-containing protein [Medicago truncatula] gi|124360182|gb|ABN08195.1| No apical meristem (NAM) protein [Medicago truncatula] gi|355484916|gb|AES66119.1| NAC domain-containing protein [Medicago truncatula] Length = 344 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM G+GE++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMQGSGELTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|AGL39670.1| NAC transcription factor 014 [Jatropha curcas] Length = 313 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 219 MAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MAGNG++SVPPGFRFHPTDEEL+YYYL+KKVSYE I L Sbjct: 1 MAGNGQLSVPPGFRFHPTDEELVYYYLKKKVSYEAIDL 38 >ref|XP_004488594.1| PREDICTED: protein SOMBRERO-like [Cicer arietinum] Length = 339 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 MM G+G+++VPPGFRFHPTDEELLYYYLRKKVSYE I L Sbjct: 1 MMQGSGQLTVPPGFRFHPTDEELLYYYLRKKVSYEAIDL 39 >gb|AFW76569.1| putative NAC domain transcription factor superfamily protein [Zea mays] Length = 369 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M G G +SVPPGFRFHPTDEELLYYYLRKKVSYEPI L Sbjct: 1 MHPGGGPLSVPPGFRFHPTDEELLYYYLRKKVSYEPIDL 39 >gb|ACF83821.1| unknown [Zea mays] gi|195659457|gb|ACG49196.1| NAC domain-containing protein 76 [Zea mays] gi|407232642|gb|AFT82663.1| NAC116 NAC type transcription factor, partial [Zea mays subsp. mays] gi|413943919|gb|AFW76568.1| putative NAC domain transcription factor superfamily protein [Zea mays] Length = 366 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M G G +SVPPGFRFHPTDEELLYYYLRKKVSYEPI L Sbjct: 1 MHPGGGPLSVPPGFRFHPTDEELLYYYLRKKVSYEPIDL 39 >emb|CAH56055.1| hypothetical protein [Zea mays] Length = 369 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +3 Query: 216 MMAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 M G G +SVPPGFRFHPTDEELLYYYLRKKVSYEPI L Sbjct: 1 MHPGGGPLSVPPGFRFHPTDEELLYYYLRKKVSYEPIDL 39 >ref|XP_006389872.1| hypothetical protein EUTSA_v10019534mg [Eutrema salsugineum] gi|557086306|gb|ESQ27158.1| hypothetical protein EUTSA_v10019534mg [Eutrema salsugineum] Length = 376 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 219 MAGNGEVSVPPGFRFHPTDEELLYYYLRKKVSYEPIVL 332 +AG G++SVPPGFRFHPT+EELLYYYL+KKVSYEPI L Sbjct: 9 VAGGGQLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDL 46