BLASTX nr result
ID: Rehmannia26_contig00033918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00033918 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY08249.1| Pentatricopeptide (PPR) repeat-containing protein... 74 3e-11 ref|XP_006296070.1| hypothetical protein CARUB_v10025220mg [Caps... 67 2e-09 ref|XP_006410794.1| hypothetical protein EUTSA_v10016603mg [Eutr... 67 3e-09 ref|XP_002528752.1| pentatricopeptide repeat-containing protein,... 67 3e-09 ref|XP_002879598.1| hypothetical protein ARALYDRAFT_902735 [Arab... 66 4e-09 dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis tha... 66 5e-09 gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|A... 66 5e-09 ref|NP_181166.3| pentatricopeptide repeat-containing protein [Ar... 66 5e-09 gb|EXB65581.1| hypothetical protein L484_025847 [Morus notabilis] 65 7e-09 ref|XP_006430195.1| hypothetical protein CICLE_v10011570mg [Citr... 65 7e-09 ref|XP_006430194.1| hypothetical protein CICLE_v10011570mg [Citr... 65 7e-09 ref|XP_006357037.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006481766.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 gb|ESW34898.1| hypothetical protein PHAVU_001G190300g [Phaseolus... 62 6e-08 ref|XP_004244475.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004494183.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CBI25159.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002264269.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_002308078.2| hypothetical protein POPTR_0006s06790g [Popu... 60 3e-07 gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] 60 3e-07 >gb|EOY08249.1| Pentatricopeptide (PPR) repeat-containing protein, putative [Theobroma cacao] Length = 492 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSKF*RLSRLIAKR 167 LI GY +EGRRKEGE+LV+EMLD+GF+PDIA YN LMDGL+ SK L ++ A R Sbjct: 435 LIYGYTREGRRKEGEILVDEMLDKGFIPDIARYNRLMDGLSNSKSLTLKKVSACR 489 >ref|XP_006296070.1| hypothetical protein CARUB_v10025220mg [Capsella rubella] gi|482564778|gb|EOA28968.1| hypothetical protein CARUB_v10025220mg [Capsella rubella] Length = 496 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSKF*R 143 L+ G+ KEGRRKEGEVLVNEMLD+ LPDI TYN LMD L+ +KF R Sbjct: 444 LVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDSLSCAKFSR 490 >ref|XP_006410794.1| hypothetical protein EUTSA_v10016603mg [Eutrema salsugineum] gi|557111963|gb|ESQ52247.1| hypothetical protein EUTSA_v10016603mg [Eutrema salsugineum] Length = 473 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKS 131 L+ G++KEGRRKEGE LVNEMLD+ LPDI TYN LMDGL+++ Sbjct: 418 LVSGFRKEGRRKEGEALVNEMLDKDMLPDIFTYNRLMDGLSRT 460 >ref|XP_002528752.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531846|gb|EEF33664.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 371 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY +EG+ KEGEVLV+EMLD+ F+PD+ATYN LMDGL KS+ Sbjct: 316 LVNGYTREGKWKEGEVLVDEMLDKEFIPDLATYNRLMDGLCKSR 359 >ref|XP_002879598.1| hypothetical protein ARALYDRAFT_902735 [Arabidopsis lyrata subsp. lyrata] gi|297325437|gb|EFH55857.1| hypothetical protein ARALYDRAFT_902735 [Arabidopsis lyrata subsp. lyrata] Length = 497 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKS 131 L+ G+ KEGRRKEGEVLVNEMLD+ LPDI TYN LMDGL+ S Sbjct: 444 LVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLSCS 486 >dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis thaliana] Length = 497 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 L+ G+ KEGRRKEGEVLVNEMLD+ LPDI TYN LMDGL+ Sbjct: 444 LVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 484 >gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|AAT70477.1| At2g36240 [Arabidopsis thaliana] Length = 379 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 L+ G+ KEGRRKEGEVLVNEMLD+ LPDI TYN LMDGL+ Sbjct: 326 LVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 366 >ref|NP_181166.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206301|sp|Q9SJN2.1|PP187_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g36240 gi|4510352|gb|AAD21441.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330254126|gb|AEC09220.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 497 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 L+ G+ KEGRRKEGEVLVNEMLD+ LPDI TYN LMDGL+ Sbjct: 444 LVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 484 >gb|EXB65581.1| hypothetical protein L484_025847 [Morus notabilis] Length = 547 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY KEG RKEGE LV+EMLD+GF+PDIA+YN LMD LA ++ Sbjct: 501 LVSGYTKEGERKEGEKLVDEMLDKGFIPDIASYNRLMDRLANTR 544 >ref|XP_006430195.1| hypothetical protein CICLE_v10011570mg [Citrus clementina] gi|557532252|gb|ESR43435.1| hypothetical protein CICLE_v10011570mg [Citrus clementina] Length = 492 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY +E RRKEGE LVNEMLD GF+PD+ATYN MDGL+ ++ Sbjct: 442 LVSGYTRENRRKEGENLVNEMLDEGFIPDLATYNSYMDGLSNAR 485 >ref|XP_006430194.1| hypothetical protein CICLE_v10011570mg [Citrus clementina] gi|557532251|gb|ESR43434.1| hypothetical protein CICLE_v10011570mg [Citrus clementina] Length = 459 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY +E RRKEGE LVNEMLD GF+PD+ATYN MDGL+ ++ Sbjct: 409 LVSGYTRENRRKEGENLVNEMLDEGFIPDLATYNSYMDGLSNAR 452 >ref|XP_006357037.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Solanum tuberosum] Length = 474 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ G+K+EG++KE E LV EMLD GF+PDIATYN L++G AKSK Sbjct: 430 LVSGFKREGKKKESEALVEEMLDLGFIPDIATYNRLINGHAKSK 473 >ref|XP_006481766.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Citrus sinensis] Length = 491 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY +E RRKEGE LVNEMLD GF+PD+ATYN MD L+ ++ Sbjct: 441 LVSGYTRENRRKEGENLVNEMLDEGFIPDLATYNSYMDRLSNAR 484 >gb|ESW34898.1| hypothetical protein PHAVU_001G190300g [Phaseolus vulgaris] gi|561036369|gb|ESW34899.1| hypothetical protein PHAVU_001G190300g [Phaseolus vulgaris] Length = 484 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ GY +EG R+EGE+LVNEMLDRGF+PD+A+YN L+ GL+ + Sbjct: 429 LVIGYMEEGGREEGELLVNEMLDRGFIPDLASYNKLISGLSNCR 472 >ref|XP_004244475.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform 1 [Solanum lycopersicum] gi|460397843|ref|XP_004244476.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform 2 [Solanum lycopersicum] gi|460397845|ref|XP_004244477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform 3 [Solanum lycopersicum] Length = 474 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ G+K+EG++KE E LV EMLD GF+PDIATYN L++G KSK Sbjct: 430 LVSGFKREGKKKEAEALVEEMLDLGFIPDIATYNRLINGETKSK 473 >ref|XP_004494183.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform X1 [Cicer arietinum] gi|502111850|ref|XP_004494184.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform X2 [Cicer arietinum] gi|502111859|ref|XP_004494185.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like isoform X3 [Cicer arietinum] Length = 486 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSKF*RLSRL 155 L+ GY E R EGE++VNEMLDRGF+PD+A+YN LMDGL+ + R R+ Sbjct: 431 LVTGYAGERNRTEGELVVNEMLDRGFIPDLASYNRLMDGLSNCQHGRRYRV 481 >emb|CBI25159.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 L+ GY +EG+RKEG+ L+NEMLD GF+PD+A+YN LM+GL+ Sbjct: 506 LVNGYSREGKRKEGKRLLNEMLDLGFIPDLASYNRLMNGLS 546 >ref|XP_002264269.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Vitis vinifera] Length = 588 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 L+ GY +EG+RKEG+ L+NEMLD GF+PD+A+YN LM+GL+ Sbjct: 539 LVNGYSREGKRKEGKRLLNEMLDLGFIPDLASYNRLMNGLS 579 >ref|XP_002308078.2| hypothetical protein POPTR_0006s06790g [Populus trichocarpa] gi|550335658|gb|EEE91601.2| hypothetical protein POPTR_0006s06790g [Populus trichocarpa] Length = 490 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLAKSK 134 L+ G +EG+RKEGE LV+EMLD+ F+PD+ATYN +DGL+K++ Sbjct: 443 LVSGCIREGKRKEGEALVDEMLDKEFIPDLATYNRFIDGLSKTR 486 >gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] Length = 481 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 3 LI*GYKKEGRRKEGEVLVNEMLDRGFLPDIATYNMLMDGLA 125 LI G+ +EGRRKEGE +V+EMLD+GF+PD+ATYN M+ LA Sbjct: 437 LIQGFIREGRRKEGEAVVDEMLDQGFIPDLATYNSFMNDLA 477