BLASTX nr result
ID: Rehmannia26_contig00033640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00033640 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera] 57 2e-06 emb|CAN60829.1| hypothetical protein VITISV_012059 [Vitis vinifera] 56 4e-06 >emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera] Length = 1262 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 ETPQQNG*MERKHQHLLQVARAFMFQSKVPLSY 100 ETP QNG +ERKHQHLL VAR+ MFQSK+PLSY Sbjct: 656 ETPXQNGRVERKHQHLLNVARSLMFQSKLPLSY 688 >emb|CAN60829.1| hypothetical protein VITISV_012059 [Vitis vinifera] Length = 1128 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 ETPQQNG*MERKHQHLLQVARAFMFQSKVPLSY 100 ETP+QNG +ERKHQHLL VAR+ MFQSK+PLS+ Sbjct: 350 ETPEQNGRVERKHQHLLNVARSLMFQSKLPLSH 382