BLASTX nr result
ID: Rehmannia26_contig00033295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00033295 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233145.1| PREDICTED: cleavage and polyadenylation spec... 66 5e-09 ref|XP_006352991.1| PREDICTED: cleavage and polyadenylation spec... 65 9e-09 ref|XP_006359103.1| PREDICTED: cleavage and polyadenylation spec... 64 2e-08 ref|XP_004231555.1| PREDICTED: cleavage and polyadenylation spec... 64 2e-08 gb|EOX96971.1| Cleavage and polyadenylation specificity factor 3... 55 7e-06 >ref|XP_004233145.1| PREDICTED: cleavage and polyadenylation specificity factor CPSF30-like [Solanum lycopersicum] Length = 671 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 228 MDDGEGGLSFDFEGGLDTGPIHPTASVPVIQ 136 MDDGEGGL+FDFEGGLDTGP HPTASVPVIQ Sbjct: 1 MDDGEGGLNFDFEGGLDTGPTHPTASVPVIQ 31 >ref|XP_006352991.1| PREDICTED: cleavage and polyadenylation specificity factor CPSF30-like [Solanum tuberosum] Length = 677 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 228 MDDGEGGLSFDFEGGLDTGPIHPTASVPVIQ 136 MDDGEGGL+FDFEGGLDTGP HPTASVPV+Q Sbjct: 1 MDDGEGGLNFDFEGGLDTGPTHPTASVPVLQ 31 >ref|XP_006359103.1| PREDICTED: cleavage and polyadenylation specificity factor CPSF30-like [Solanum tuberosum] Length = 692 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 228 MDDGEGGLSFDFEGGLDTGPIHPTASVPVIQ 136 MD+GEGGL+FDFEGGLDTGP HPTASVPVIQ Sbjct: 1 MDEGEGGLNFDFEGGLDTGPTHPTASVPVIQ 31 >ref|XP_004231555.1| PREDICTED: cleavage and polyadenylation specificity factor CPSF30-like [Solanum lycopersicum] Length = 689 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 228 MDDGEGGLSFDFEGGLDTGPIHPTASVPVIQ 136 MD+GEGGL+FDFEGGLDTGP HPTASVPVIQ Sbjct: 1 MDEGEGGLNFDFEGGLDTGPTHPTASVPVIQ 31 >gb|EOX96971.1| Cleavage and polyadenylation specificity factor 30 [Theobroma cacao] Length = 698 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 228 MDDGEGGLSFDFEGGLDTGPIHPTASVPVI 139 MDD EGGLSFDFEGGLD GP PTAS+PV+ Sbjct: 1 MDDSEGGLSFDFEGGLDAGPAAPTASMPVV 30