BLASTX nr result
ID: Rehmannia26_contig00033255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00033255 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58344.1| hypothetical protein M569_16472, partial [Genlise... 55 1e-05 >gb|EPS58344.1| hypothetical protein M569_16472, partial [Genlisea aurea] Length = 225 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +1 Query: 1 KFGMFYVVHIRDYIYENPAPVNKNAVPILSHYCSIITRL 117 KFG+ ++V +RDY + P+NK AVPIL+HYCSIITRL Sbjct: 108 KFGVVHLVDLRDYKSSDSFPINKKAVPILAHYCSIITRL 146