BLASTX nr result
ID: Rehmannia26_contig00033061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00033061 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366788.1| PREDICTED: GDSL esterase/lipase At5g03820-li... 65 1e-08 ref|XP_006338923.1| PREDICTED: GDSL esterase/lipase At5g03820-li... 65 1e-08 ref|XP_004249641.1| PREDICTED: GDSL esterase/lipase At5g03820-li... 65 1e-08 ref|XP_004246904.1| PREDICTED: GDSL esterase/lipase At5g03820-li... 65 1e-08 gb|EXB75952.1| GDSL esterase/lipase [Morus notabilis] 59 7e-07 ref|XP_006430343.1| hypothetical protein CICLE_v10013829mg [Citr... 56 4e-06 ref|XP_002326231.1| predicted protein [Populus trichocarpa] gi|5... 55 7e-06 >ref|XP_006366788.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum] Length = 350 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPS+SANEKLAQSLLEQGFDLIS Sbjct: 321 YVFWDGFHPSQSANEKLAQSLLEQGFDLIS 350 >ref|XP_006338923.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum] Length = 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPSE+ANEKLAQSLLEQGFDLIS Sbjct: 319 YVFWDGFHPSEAANEKLAQSLLEQGFDLIS 348 >ref|XP_004249641.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum lycopersicum] Length = 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPSE+ANEKLAQSLLEQGFDLIS Sbjct: 319 YVFWDGFHPSEAANEKLAQSLLEQGFDLIS 348 >ref|XP_004246904.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum lycopersicum] Length = 350 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPS+SANEKLAQSLLEQGFDLIS Sbjct: 321 YVFWDGFHPSQSANEKLAQSLLEQGFDLIS 350 >gb|EXB75952.1| GDSL esterase/lipase [Morus notabilis] Length = 353 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPSESANE LA LLEQGFDLIS Sbjct: 324 YVFWDGFHPSESANEVLAGDLLEQGFDLIS 353 >ref|XP_006430343.1| hypothetical protein CICLE_v10013829mg [Citrus clementina] gi|557532400|gb|ESR43583.1| hypothetical protein CICLE_v10013829mg [Citrus clementina] Length = 347 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPSE+AN+ LA LLEQGFDLIS Sbjct: 318 YVFWDGFHPSEAANKVLAGDLLEQGFDLIS 347 >ref|XP_002326231.1| predicted protein [Populus trichocarpa] gi|566175817|ref|XP_006381340.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa] gi|550336042|gb|ERP59137.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa] Length = 351 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 349 YVFWDGFHPSESANEKLAQSLLEQGFDLIS 260 YVFWDGFHPSE+AN+ LA LL+QGFDLIS Sbjct: 322 YVFWDGFHPSEAANQVLAGDLLQQGFDLIS 351