BLASTX nr result
ID: Rehmannia26_contig00032357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032357 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] 67 2e-09 >gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] Length = 422 Score = 66.6 bits (161), Expect(2) = 2e-09 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -2 Query: 214 MSQKR-QQQEEGSSFDDKRLRKSHSFRRVVLDVMNLMKLQNLINPVLEPLIRRVFVS 47 MS+KR Q+ E+GSS D R RKS SF+ VVLDVMN+ +LQN + PVLEPLIRRV S Sbjct: 1 MSKKRLQRDEDGSSSQDWRPRKSPSFKSVVLDVMNIQRLQNFMVPVLEPLIRRVVSS 57 Score = 20.4 bits (41), Expect(2) = 2e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 32 VKEEVDSAL 6 VKEEVDSAL Sbjct: 64 VKEEVDSAL 72