BLASTX nr result
ID: Rehmannia26_contig00032355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032355 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347090.1| PREDICTED: uncharacterized protein LOC102579... 102 7e-20 ref|XP_006347088.1| PREDICTED: uncharacterized protein LOC102579... 102 7e-20 gb|EOY11470.1| Zinc finger isoform 4 [Theobroma cacao] gi|508719... 102 7e-20 gb|EOY11469.1| Zinc finger isoform 3 [Theobroma cacao] 102 7e-20 gb|EOY11468.1| Zinc finger isoform 2 [Theobroma cacao] 102 7e-20 gb|EOY11467.1| Zinc finger isoform 1 [Theobroma cacao] 102 7e-20 gb|EXC44874.1| hypothetical protein L484_000389 [Morus notabilis] 101 1e-19 gb|EXC02777.1| Lysine-specific demethylase 3B [Morus notabilis] 101 1e-19 ref|XP_002512411.1| transcription factor, putative [Ricinus comm... 100 2e-19 ref|XP_002279731.2| PREDICTED: uncharacterized protein LOC100249... 100 3e-19 ref|XP_006472061.1| PREDICTED: uncharacterized protein LOC102630... 95 1e-17 ref|XP_006433389.1| hypothetical protein CICLE_v10000178mg [Citr... 95 1e-17 ref|XP_006433388.1| hypothetical protein CICLE_v10000178mg [Citr... 95 1e-17 ref|XP_006433387.1| hypothetical protein CICLE_v10000178mg [Citr... 95 1e-17 ref|XP_004232827.1| PREDICTED: uncharacterized protein LOC101261... 95 1e-17 gb|EPS58501.1| hypothetical protein M569_16313, partial [Genlise... 93 3e-17 gb|EMJ09853.1| hypothetical protein PRUPE_ppa020523mg, partial [... 92 5e-17 ref|XP_002330209.1| predicted protein [Populus trichocarpa] 90 3e-16 ref|XP_004168527.1| PREDICTED: uncharacterized protein LOC101227... 90 4e-16 ref|XP_006382499.1| transcription factor jumonji domain-containi... 89 5e-16 >ref|XP_006347090.1| PREDICTED: uncharacterized protein LOC102579305 isoform X3 [Solanum tuberosum] Length = 914 Score = 102 bits (253), Expect = 7e-20 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 144 LMDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 LMDHPRS SG GEDN+GIPDDLRCKRSDGKQWRCTA+SMPDKTVCEKH Sbjct: 2 LMDHPRSSSGPGEDNIGIPDDLRCKRSDGKQWRCTALSMPDKTVCEKH 49 >ref|XP_006347088.1| PREDICTED: uncharacterized protein LOC102579305 isoform X1 [Solanum tuberosum] gi|565360669|ref|XP_006347089.1| PREDICTED: uncharacterized protein LOC102579305 isoform X2 [Solanum tuberosum] Length = 949 Score = 102 bits (253), Expect = 7e-20 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 144 LMDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 LMDHPRS SG GEDN+GIPDDLRCKRSDGKQWRCTA+SMPDKTVCEKH Sbjct: 2 LMDHPRSSSGPGEDNIGIPDDLRCKRSDGKQWRCTALSMPDKTVCEKH 49 >gb|EOY11470.1| Zinc finger isoform 4 [Theobroma cacao] gi|508719574|gb|EOY11471.1| Zinc finger isoform 4 [Theobroma cacao] Length = 826 Score = 102 bits (253), Expect = 7e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS SG GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSGSGNGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >gb|EOY11469.1| Zinc finger isoform 3 [Theobroma cacao] Length = 855 Score = 102 bits (253), Expect = 7e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS SG GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSGSGNGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >gb|EOY11468.1| Zinc finger isoform 2 [Theobroma cacao] Length = 915 Score = 102 bits (253), Expect = 7e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS SG GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSGSGNGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >gb|EOY11467.1| Zinc finger isoform 1 [Theobroma cacao] Length = 947 Score = 102 bits (253), Expect = 7e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS SG GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSGSGNGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >gb|EXC44874.1| hypothetical protein L484_000389 [Morus notabilis] Length = 213 Score = 101 bits (251), Expect = 1e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS +G GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSTTGTGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >gb|EXC02777.1| Lysine-specific demethylase 3B [Morus notabilis] Length = 949 Score = 101 bits (251), Expect = 1e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS +G GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSTTGTGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_002512411.1| transcription factor, putative [Ricinus communis] gi|223548372|gb|EEF49863.1| transcription factor, putative [Ricinus communis] Length = 923 Score = 100 bits (249), Expect = 2e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MD+PRS SG GEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDNPRSASGNGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_002279731.2| PREDICTED: uncharacterized protein LOC100249389 [Vitis vinifera] Length = 946 Score = 100 bits (248), Expect = 3e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS SG GEDNVGIP+DLRCKRSDGKQWRC+AMSMPDKTVCEKH Sbjct: 1 MDHPRSTSGNGEDNVGIPEDLRCKRSDGKQWRCSAMSMPDKTVCEKH 47 >ref|XP_006472061.1| PREDICTED: uncharacterized protein LOC102630420 isoform X1 [Citrus sinensis] gi|568836051|ref|XP_006472062.1| PREDICTED: uncharacterized protein LOC102630420 isoform X2 [Citrus sinensis] gi|568836053|ref|XP_006472063.1| PREDICTED: uncharacterized protein LOC102630420 isoform X3 [Citrus sinensis] Length = 956 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDH RS G GEDN GIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHQRSSLGNGEDNGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_006433389.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] gi|557535511|gb|ESR46629.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] Length = 829 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDH RS G GEDN GIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHQRSSLGNGEDNGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_006433388.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] gi|568836055|ref|XP_006472064.1| PREDICTED: uncharacterized protein LOC102630420 isoform X4 [Citrus sinensis] gi|557535510|gb|ESR46628.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] Length = 952 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDH RS G GEDN GIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHQRSSLGNGEDNGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_006433387.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] gi|568836057|ref|XP_006472065.1| PREDICTED: uncharacterized protein LOC102630420 isoform X5 [Citrus sinensis] gi|557535509|gb|ESR46627.1| hypothetical protein CICLE_v10000178mg [Citrus clementina] Length = 947 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDH RS G GEDN GIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHQRSSLGNGEDNGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 47 >ref|XP_004232827.1| PREDICTED: uncharacterized protein LOC101261570 [Solanum lycopersicum] Length = 912 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MD+PRS SG EDN+GIPDDLRCKRSDGKQWRCTA+SMPDKTVCEKH Sbjct: 1 MDYPRSSSGPVEDNIGIPDDLRCKRSDGKQWRCTALSMPDKTVCEKH 47 >gb|EPS58501.1| hypothetical protein M569_16313, partial [Genlisea aurea] Length = 650 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -3 Query: 141 MDHPRSI-SGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDH R + +GG EDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHTRILPAGGSEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 48 >gb|EMJ09853.1| hypothetical protein PRUPE_ppa020523mg, partial [Prunus persica] Length = 971 Score = 92.4 bits (228), Expect = 5e-17 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MD PRS G GE+NVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDQPRS--GNGEENVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 45 >ref|XP_002330209.1| predicted protein [Populus trichocarpa] Length = 979 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/49 (83%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = -3 Query: 144 LMDHPRSISGGGEDNVG-IPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 +MDHPRS GE+N G IPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 11 IMDHPRSSLANGEENGGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 59 >ref|XP_004168527.1| PREDICTED: uncharacterized protein LOC101227379 [Cucumis sativus] Length = 936 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 141 MDHPRSISGGGEDNVGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MD PRS S GED VGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDLPRSTSANGED-VGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 46 >ref|XP_006382499.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] gi|550337860|gb|ERP60296.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] Length = 968 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/48 (85%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -3 Query: 141 MDHPRSISGGGEDNVG-IPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 1 MDHPRS GE+N G IPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH Sbjct: 1 MDHPRSSLANGEENGGGIPDDLRCKRSDGKQWRCTAMSMPDKTVCEKH 48