BLASTX nr result
ID: Rehmannia26_contig00031602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031602 (644 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250340.1| PREDICTED: uncharacterized protein At1g04910... 69 1e-09 ref|XP_006351922.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-09 >ref|XP_004250340.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum] Length = 553 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 642 IMVPRVKKSTRKGSIYLNPLPECRCLWESQNTTAPSDMF 526 IMVPRVKKSTRKGSIY NPLPECRCLWES+ TT S+ + Sbjct: 510 IMVPRVKKSTRKGSIYSNPLPECRCLWESKRTTNRSNSY 548 >ref|XP_006351922.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum] Length = 424 Score = 67.4 bits (163), Expect = 3e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 642 IMVPRVKKSTRKGSIYLNPLPECRCLWESQNTTAPSDMF 526 IMVPR KKSTRKGSIY NPLPECRCLWES+ TT S+ + Sbjct: 381 IMVPRAKKSTRKGSIYSNPLPECRCLWESKRTTNRSNSY 419