BLASTX nr result
ID: Rehmannia26_contig00031449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031449 (653 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arab... 59 1e-06 >ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata] gi|297334194|gb|EFH64612.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 651 KSRLGCFNGSLYIFPFTRSVGKKWALEVLLI 559 KSR+GCFNGS YIFP +RSVGKKW LE+LLI Sbjct: 29 KSRMGCFNGSFYIFPLSRSVGKKWTLEILLI 59