BLASTX nr result
ID: Rehmannia26_contig00031303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031303 (642 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 100 3e-19 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 81 7e-16 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 1e-09 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 54 6e-09 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 57 5e-06 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 100 bits (250), Expect = 3e-19 Identities = 50/57 (87%), Positives = 50/57 (87%) Frame = +2 Query: 470 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHF*SALVNRSPPIKQEGSGSSHG 640 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGEHF SALVN SP IKQE SG SHG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHG 57 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 80.9 bits (198), Expect(2) = 7e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 604 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKV 494 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 29.3 bits (64), Expect(2) = 7e-16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 642 PPWEEPLPSCLMGG 601 PPWEEPL SCL+ G Sbjct: 4 PPWEEPLLSCLIVG 17 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 470 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGE 571 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 54.3 bits (129), Expect(2) = 6e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 430 SRDRLSFKPLSFGSDKSSPFGRFAQV 353 +RDRLSFKPLSFGSDKSSPFGRFAQV Sbjct: 9 ARDRLSFKPLSFGSDKSSPFGRFAQV 34 Score = 32.3 bits (72), Expect(2) = 6e-09 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -1 Query: 360 LRWSS--LIFPNVQRFE-MRKEHRPSAMNE 280 +RWSS + FPNV+ +RKEHRPS +NE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -3 Query: 613 LDGGASIHQRRLKVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPSIK 440 L G SI Q RLKVL EPC I+T++T GD VKALDPLPHTL+ SS IK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72