BLASTX nr result
ID: Rehmannia26_contig00031065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031065 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransf... 71 2e-10 emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera] 71 2e-10 ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransf... 62 6e-08 ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransf... 62 8e-08 ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransf... 57 3e-06 gb|EOY20760.1| Tryptophan biosynthesis 1 [Theobroma cacao] 56 6e-06 gb|EMJ12238.1| hypothetical protein PRUPE_ppa019367mg, partial [... 55 7e-06 >ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|296087637|emb|CBI34893.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -2 Query: 147 RHPLQLPISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 R PL LPI+S ++L+ECLLN+ED +EEEAE SL+FLL+ G+EALISAFL Sbjct: 54 RAPLDLPITSSRQLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFL 102 >emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera] Length = 830 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -2 Query: 147 RHPLQLPISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 R PL LPI+S ++L+ECLLN+ED +EEEAE SL+FLL+ G+EALISAFL Sbjct: 446 RAPLDLPITSSRQLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFL 494 >ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Solanum tuberosum] Length = 384 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = -2 Query: 138 LQLPISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 L LP S ++L+E LLNKEDLNE EAE SLDFLL G+EALISAFL Sbjct: 41 LHLPNLSSQQLMERLLNKEDLNEAEAEASLDFLLKDGSEALISAFL 86 >ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Solanum lycopersicum] Length = 386 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -2 Query: 138 LQLPISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 L LPI S ++L+E LL KEDLNE EAE SLDF+L G+EALISAFL Sbjct: 43 LHLPILSSQQLMERLLKKEDLNEAEAEASLDFMLKDGSEALISAFL 88 >ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|297733759|emb|CBI15006.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -2 Query: 141 PLQLPISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 P+ P +S +LIE L+++ DL E EAE SLDFLLS NEALISAFL Sbjct: 47 PISAPPTSFNKLIESLISRVDLTESEAEASLDFLLSEANEALISAFL 93 >gb|EOY20760.1| Tryptophan biosynthesis 1 [Theobroma cacao] Length = 424 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 126 ISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 I S ELIE L+N+ DL E EAE SLDFLL+ NEALISAFL Sbjct: 75 IGSINELIESLINRVDLTESEAEASLDFLLAEANEALISAFL 116 >gb|EMJ12238.1| hypothetical protein PRUPE_ppa019367mg, partial [Prunus persica] Length = 396 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 129 PISSPKELIECLLNKEDLNEEEAEGSLDFLLSHGNEALISAFL 1 PI+S KELIE L+++ DL+E EAE SL+FLL NEALISAFL Sbjct: 62 PIASFKELIESLIDRVDLSEAEAEDSLEFLLRDANEALISAFL 104