BLASTX nr result
ID: Rehmannia26_contig00031062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031062 (659 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67923.1| hypothetical protein M569_06848, partial [Genlise... 69 2e-09 ref|XP_006477621.1| PREDICTED: probable leucine-rich repeat rece... 67 6e-09 ref|XP_006440692.1| hypothetical protein CICLE_v10021138mg [Citr... 67 6e-09 ref|XP_006280810.1| hypothetical protein CARUB_v10026779mg [Caps... 67 6e-09 gb|AGJ70091.1| LRR-like disease resistance protein [Brassica ole... 67 6e-09 ref|XP_004157333.1| PREDICTED: probable leucine-rich repeat rece... 67 6e-09 ref|XP_004143790.1| PREDICTED: probable leucine-rich repeat rece... 67 6e-09 gb|ABZ85667.1| LRR-like disease resistance protein [Brassica rap... 67 6e-09 gb|EXB65078.1| hypothetical protein L484_004254 [Morus notabilis] 66 1e-08 ref|NP_200932.2| leucine-rich repeat-containing protein [Arabido... 65 1e-08 gb|ESW29576.1| hypothetical protein PHAVU_002G081300g [Phaseolus... 65 1e-08 gb|EOY21992.1| Leucine-rich repeat family protein isoform 2 [The... 65 1e-08 gb|EOY21991.1| Leucine-rich repeat (LRR) family protein isoform ... 65 1e-08 ref|XP_004297259.1| PREDICTED: probable leucine-rich repeat rece... 65 1e-08 gb|EMJ26890.1| hypothetical protein PRUPE_ppa008519mg [Prunus pe... 65 1e-08 ref|NP_001190586.1| leucine-rich repeat-containing protein [Arab... 65 1e-08 ref|XP_002864726.1| protein binding protein [Arabidopsis lyrata ... 65 1e-08 dbj|BAD94317.1| Cf-5 disease resistance protein - like [Arabidop... 65 1e-08 gb|AAK70805.1| leucine-rich repeat resistance protein-like prote... 65 1e-08 ref|XP_006394525.1| hypothetical protein EUTSA_v10004587mg [Eutr... 65 2e-08 >gb|EPS67923.1| hypothetical protein M569_06848, partial [Genlisea aurea] Length = 325 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPDTFYKHPFLKEMYIEGN Sbjct: 271 YLYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 301 >ref|XP_006477621.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Citrus sinensis] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKEMYIEGN Sbjct: 272 YLYLDHNQFSGRIPDAFYKHPFLKEMYIEGN 302 >ref|XP_006440692.1| hypothetical protein CICLE_v10021138mg [Citrus clementina] gi|557542954|gb|ESR53932.1| hypothetical protein CICLE_v10021138mg [Citrus clementina] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKEMYIEGN Sbjct: 272 YLYLDHNQFSGRIPDAFYKHPFLKEMYIEGN 302 >ref|XP_006280810.1| hypothetical protein CARUB_v10026779mg [Capsella rubella] gi|482549514|gb|EOA13708.1| hypothetical protein CARUB_v10026779mg [Capsella rubella] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKEMYIEGN Sbjct: 272 YLYLDHNQFSGRIPDAFYKHPFLKEMYIEGN 302 >gb|AGJ70091.1| LRR-like disease resistance protein [Brassica oleracea var. italica] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 F YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 272 FLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 302 >ref|XP_004157333.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 227 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKEMYIEGN Sbjct: 173 YLYLDHNQFSGRIPDAFYKHPFLKEMYIEGN 203 >ref|XP_004143790.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 330 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKEMYIEGN Sbjct: 276 YLYLDHNQFSGRIPDAFYKHPFLKEMYIEGN 306 >gb|ABZ85667.1| LRR-like disease resistance protein [Brassica rapa subsp. pekinensis] Length = 327 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 F YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 272 FLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 302 >gb|EXB65078.1| hypothetical protein L484_004254 [Morus notabilis] Length = 329 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD+FYKHPFLKEMYIEGN Sbjct: 275 YLYLDHNQFTGRIPDSFYKHPFLKEMYIEGN 305 >ref|NP_200932.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|9757845|dbj|BAB08479.1| leucine-rich repeat disease resistance protein-like [Arabidopsis thaliana] gi|22135942|gb|AAM91553.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana] gi|23197592|gb|AAN15323.1| Cf-5 disease resistance protein-like [Arabidopsis thaliana] gi|332010057|gb|AED97440.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 326 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 272 YLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 302 >gb|ESW29576.1| hypothetical protein PHAVU_002G081300g [Phaseolus vulgaris] Length = 356 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 YLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 YLDHNQFSGR+PD FYKHPFLKEMYIEGN Sbjct: 304 YLDHNQFSGRVPDPFYKHPFLKEMYIEGN 332 >gb|EOY21992.1| Leucine-rich repeat family protein isoform 2 [Theobroma cacao] Length = 302 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKE+YIEGN Sbjct: 248 YLYLDHNQFSGRIPDAFYKHPFLKELYIEGN 278 >gb|EOY21991.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] Length = 326 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKE+YIEGN Sbjct: 272 YLYLDHNQFSGRIPDAFYKHPFLKELYIEGN 302 >ref|XP_004297259.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Fragaria vesca subsp. vesca] Length = 329 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLK+MYIEGN Sbjct: 275 YLYLDHNQFSGRIPDAFYKHPFLKDMYIEGN 305 >gb|EMJ26890.1| hypothetical protein PRUPE_ppa008519mg [Prunus persica] Length = 328 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLK+MYIEGN Sbjct: 274 YLYLDHNQFSGRIPDAFYKHPFLKDMYIEGN 304 >ref|NP_001190586.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332010058|gb|AED97441.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 339 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 285 YLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 315 >ref|XP_002864726.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310561|gb|EFH40985.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Length = 326 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 272 YLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 302 >dbj|BAD94317.1| Cf-5 disease resistance protein - like [Arabidopsis thaliana] Length = 56 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD FYKHPFLKEMYIEGN Sbjct: 2 YLYLDHNQFTGRIPDAFYKHPFLKEMYIEGN 32 >gb|AAK70805.1| leucine-rich repeat resistance protein-like protein [Gossypium hirsutum] Length = 328 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQFSGRIPD FYKHPFLKE+YIEGN Sbjct: 274 YLYLDHNQFSGRIPDAFYKHPFLKELYIEGN 304 >ref|XP_006394525.1| hypothetical protein EUTSA_v10004587mg [Eutrema salsugineum] gi|557091164|gb|ESQ31811.1| hypothetical protein EUTSA_v10004587mg [Eutrema salsugineum] Length = 326 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 95 FRYLDHNQFSGRIPDTFYKHPFLKEMYIEGN 3 + YLDHNQF+GRIPD FYKHPFLKEMY+EGN Sbjct: 272 YLYLDHNQFTGRIPDAFYKHPFLKEMYVEGN 302