BLASTX nr result
ID: Rehmannia26_contig00030765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00030765 (419 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99134.1| hypothetical protein L484_007042 [Morus notabilis] 62 6e-08 >gb|EXB99134.1| hypothetical protein L484_007042 [Morus notabilis] Length = 148 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/56 (46%), Positives = 42/56 (75%) Frame = +1 Query: 1 EYLNKVKAYCDCLTISGQKISNDEHVSHVLAGLGSEYNVAMVSIGARVEPCSLREL 168 EYL K+KAYCD L G KIS+++H+ H+L+ LG++Y MV+I +R EP +++++ Sbjct: 45 EYLTKMKAYCDVLASVGHKISDEDHILHILSSLGTKYVPVMVTITSRTEPWTVKDV 100