BLASTX nr result
ID: Rehmannia26_contig00030603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00030603 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB77029.1| 50S ribosomal protein L4 [Morus notabilis] 72 6e-11 ref|XP_004252759.1| PREDICTED: 50S ribosomal protein L4-like iso... 71 1e-10 gb|EOY28803.1| Ribosomal protein L4/L1 family isoform 1 [Theobro... 70 3e-10 ref|XP_006342636.1| PREDICTED: 39S ribosomal protein L4, mitocho... 67 2e-09 ref|XP_004252760.1| PREDICTED: 50S ribosomal protein L4-like iso... 65 7e-09 ref|XP_004134779.1| PREDICTED: 50S ribosomal protein L4-like [Cu... 62 8e-08 ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus ... 62 1e-07 ref|XP_006383860.1| hypothetical protein POPTR_0004s00660g [Popu... 60 3e-07 ref|XP_006383858.1| hypothetical protein POPTR_0004s00660g [Popu... 60 3e-07 ref|XP_006467374.1| PREDICTED: 39S ribosomal protein L4, mitocho... 58 1e-06 gb|EPS72544.1| hypothetical protein M569_02212, partial [Genlise... 56 6e-06 ref|XP_006298209.1| hypothetical protein CARUB_v10014259mg [Caps... 55 1e-05 >gb|EXB77029.1| 50S ribosomal protein L4 [Morus notabilis] Length = 297 Score = 72.4 bits (176), Expect = 6e-11 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 11/100 (11%) Frame = +2 Query: 65 SISRRVLRAVGSSDVS-------FVSTSLCKAFNSYGY--GDSSPSLQFSVL--GKTSFD 211 SISRR+LRA+GSS S S SLC + Y + GDS S S + G +SF Sbjct: 4 SISRRILRALGSSSASSRCYYSSITSPSLCTTHDLYNHVPGDSLLSADSSGILKGGSSFL 63 Query: 212 VCRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 R+ ST +LTP SSEG FPS+LLS+K V+ DREIGLY+ Sbjct: 64 SHRKLST-VLTPESSEGVFPSDLLSAKPVVAADREIGLYQ 102 >ref|XP_004252759.1| PREDICTED: 50S ribosomal protein L4-like isoform 1 [Solanum lycopersicum] Length = 305 Score = 71.2 bits (173), Expect = 1e-10 Identities = 44/90 (48%), Positives = 57/90 (63%), Gaps = 1/90 (1%) Frame = +2 Query: 65 SISRRVLRAVGS-SDVSFVSTSLCKAFNSYGYGDSSPSLQFSVLGKTSFDVCRRYSTMIL 241 SISRR+LR+ S + + +S S KA N G G S ++ F CRRYST +L Sbjct: 4 SISRRILRSFASLNSLRTLSASNVKA-NILGDGVSCVESSAFRKDESLFLACRRYSTSLL 62 Query: 242 TPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 TP+SS+G FPS+LLS K V TP+REIGL + Sbjct: 63 TPDSSDGSFPSDLLSKKRVSTPEREIGLLQ 92 >gb|EOY28803.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao] gi|508781548|gb|EOY28804.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao] gi|508781549|gb|EOY28805.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao] Length = 315 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/99 (43%), Positives = 57/99 (57%), Gaps = 10/99 (10%) Frame = +2 Query: 65 SISRRVLRAVGSSDVSFVSTSLCKAFNSYGYGDSSPSLQFSVL----------GKTSFDV 214 SISRR+LR+ GS SL +S+ D + + L G SF Sbjct: 4 SISRRILRSFGSLSALARWDSLTIPSHSFQASDLNACISGDNLPHAECFSFSKGGLSFLA 63 Query: 215 CRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 CR+++T ILTP+S+E FPS+LLS+K VLTPDR IGLY+ Sbjct: 64 CRKFATTILTPDSAESAFPSDLLSAKTVLTPDRTIGLYQ 102 >ref|XP_006342636.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Solanum tuberosum] Length = 305 Score = 67.0 bits (162), Expect = 2e-09 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%) Frame = +2 Query: 65 SISRRVLRAVGS-SDVSFVSTSLCKAFNSYGYGDSSPSLQFSVLGKTSFDVCRRYSTMIL 241 SISRR+LR+ S + + +S S KA N G G S ++ F CRRYST +L Sbjct: 4 SISRRILRSFTSLNSLRPLSASNVKA-NILGDGVSWVESSVFRKDESLFLACRRYSTSLL 62 Query: 242 TPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 TP+SS+G FPS+LLS K V P+REIGL + Sbjct: 63 TPDSSDGSFPSDLLSKKRVSIPEREIGLLQ 92 >ref|XP_004252760.1| PREDICTED: 50S ribosomal protein L4-like isoform 2 [Solanum lycopersicum] Length = 296 Score = 65.5 bits (158), Expect = 7e-09 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +2 Query: 65 SISRRVLRAVGS-SDVSFVSTSLCKAFNSYGYGDSSPSLQFSVLGKTSFDVCRRYSTMIL 241 SISRR+LR+ S + + +S S S + ++ F CRRYST +L Sbjct: 4 SISRRILRSFASLNSLRTLSASNVSCVESSAFRKD----------ESLFLACRRYSTSLL 53 Query: 242 TPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 TP+SS+G FPS+LLS K V TP+REIGL + Sbjct: 54 TPDSSDGSFPSDLLSKKRVSTPEREIGLLQ 83 >ref|XP_004134779.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus] gi|449531047|ref|XP_004172499.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus] Length = 315 Score = 62.0 bits (149), Expect = 8e-08 Identities = 44/99 (44%), Positives = 54/99 (54%), Gaps = 10/99 (10%) Frame = +2 Query: 65 SISRRVLRAVGSSDVSFVSTSLCKAFNS-------YGY--GDSSPSLQFSVLGKT-SFDV 214 S+SRR+LR+VGS S C S YG+ G SS S L K SF Sbjct: 4 SVSRRLLRSVGSLSTFGQCNSSCTMSRSFSNPHEIYGHVSGSSSTFASRSTLLKAGSFLA 63 Query: 215 CRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 R + T ILTP SS FPSELLS+K V + +R+IGLY+ Sbjct: 64 SRGFCTSILTPESSNNAFPSELLSAKPVASEERKIGLYQ 102 >ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus communis] gi|223542267|gb|EEF43809.1| 50S ribosomal protein L4, putative [Ricinus communis] Length = 294 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/89 (43%), Positives = 50/89 (56%) Frame = +2 Query: 65 SISRRVLRAVGSSDVSFVSTSLCKAFNSYGYGDSSPSLQFSVLGKTSFDVCRRYSTMILT 244 SISRR+LR+ S + + S S F G S CR+ ST ILT Sbjct: 4 SISRRILRSFRS----------LPSLTHQSFRASHESSSFIKNGAASL-ACRKLSTSILT 52 Query: 245 PNSSEGGFPSELLSSKHVLTPDREIGLYE 331 P SS+ FPS+LLS+K +LTP+REIGL+E Sbjct: 53 PGSSDDAFPSDLLSTKTLLTPEREIGLHE 81 >ref|XP_006383860.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa] gi|550340007|gb|ERP61657.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa] Length = 317 Score = 60.1 bits (144), Expect = 3e-07 Identities = 42/101 (41%), Positives = 57/101 (56%), Gaps = 12/101 (11%) Frame = +2 Query: 65 SISRRVLRAVGS--------SDVSFVSTSLCKAFNSYGY--GDSSPSLQFS--VLGKTSF 208 SISR+VLR+ GS S S + + YG+ GD S + S + G S Sbjct: 4 SISRKVLRSFGSLSGFGRCGDSSSLTRQSFRASHDLYGHVSGDCLFSAESSSFIKGAVSS 63 Query: 209 DVCRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 RR ST +T S++G FPS+LLS+K+V+TP REIGLY+ Sbjct: 64 LAHRRLSTSNVTSESTDGSFPSDLLSAKNVVTPQREIGLYQ 104 >ref|XP_006383858.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa] gi|550340005|gb|ERP61655.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa] Length = 277 Score = 60.1 bits (144), Expect = 3e-07 Identities = 42/101 (41%), Positives = 57/101 (56%), Gaps = 12/101 (11%) Frame = +2 Query: 65 SISRRVLRAVGS--------SDVSFVSTSLCKAFNSYGY--GDSSPSLQFS--VLGKTSF 208 SISR+VLR+ GS S S + + YG+ GD S + S + G S Sbjct: 4 SISRKVLRSFGSLSGFGRCGDSSSLTRQSFRASHDLYGHVSGDCLFSAESSSFIKGAVSS 63 Query: 209 DVCRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 RR ST +T S++G FPS+LLS+K+V+TP REIGLY+ Sbjct: 64 LAHRRLSTSNVTSESTDGSFPSDLLSAKNVVTPQREIGLYQ 104 >ref|XP_006467374.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Citrus sinensis] Length = 310 Score = 58.2 bits (139), Expect = 1e-06 Identities = 41/96 (42%), Positives = 54/96 (56%), Gaps = 7/96 (7%) Frame = +2 Query: 65 SISRRVLRAVGSSDV-------SFVSTSLCKAFNSYGYGDSSPSLQFSVLGKTSFDVCRR 223 ++SRR+LR GS S S S+ + Y S +L F + SF R+ Sbjct: 4 TVSRRLLRRFGSFSAFGRYESPSLTSRSIRSPPDLY-VACSGDNL-FPLKSGLSFLASRK 61 Query: 224 YSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 +ST ILTP+SSEG FPS+LL K VLTPD IGL++ Sbjct: 62 FSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQ 97 >gb|EPS72544.1| hypothetical protein M569_02212, partial [Genlisea aurea] Length = 295 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 206 FDVCRRYSTMILTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 F + R YST +LTPN EG P LLS++ VLTPDR+IGLY+ Sbjct: 41 FGIFRLYSTTVLTPNPDEGKIPPHLLSTRQVLTPDRKIGLYQ 82 >ref|XP_006298209.1| hypothetical protein CARUB_v10014259mg [Capsella rubella] gi|482566918|gb|EOA31107.1| hypothetical protein CARUB_v10014259mg [Capsella rubella] Length = 303 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/91 (40%), Positives = 53/91 (58%), Gaps = 2/91 (2%) Frame = +2 Query: 65 SISRRVLRAVGSSDVSFVSTSLCKAFNSYGYGDSS--PSLQFSVLGKTSFDVCRRYSTMI 238 SISR + R +GS ++ + N+ G G SS L++ + +S R+ ST I Sbjct: 4 SISRSIFRTIGSLTALGRGSTPNLSVNASGNGLSSLTSDLKYGMALLSS----RKLSTSI 59 Query: 239 LTPNSSEGGFPSELLSSKHVLTPDREIGLYE 331 LTP+SS+ FPS+LL+ VLTPDR IG Y+ Sbjct: 60 LTPDSSDDTFPSDLLTKTTVLTPDRTIGQYQ 90