BLASTX nr result
ID: Rehmannia26_contig00030353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00030353 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344783.1| PREDICTED: uncharacterized protein LOC102586... 56 4e-06 >ref|XP_006344783.1| PREDICTED: uncharacterized protein LOC102586363 [Solanum tuberosum] Length = 102 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +2 Query: 68 FRWLDVSFSVPTSFFRWPRLFASYLTPPSWTPSFSYSFRTLEPWRWA-PHLRLP 226 FRW+ +SFS+PTSF RWPR+F SY TP + S P RW+ P L LP Sbjct: 14 FRWIRLSFSLPTSFMRWPRMFTSYFTPNGSSRSHDGVVSASSPRRWSWPGLDLP 67