BLASTX nr result
ID: Rehmannia26_contig00028940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028940 (1013 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002986713.1| hypothetical protein SELMODRAFT_124621 [Sela... 58 5e-06 ref|XP_002990718.1| hypothetical protein SELMODRAFT_236113 [Sela... 58 5e-06 ref|XP_001760240.1| predicted protein [Physcomitrella patens] gi... 57 9e-06 >ref|XP_002986713.1| hypothetical protein SELMODRAFT_124621 [Selaginella moellendorffii] gi|300145601|gb|EFJ12276.1| hypothetical protein SELMODRAFT_124621 [Selaginella moellendorffii] Length = 411 Score = 58.2 bits (139), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 64 MKCFVENVAGTTLNYSLDDRINRAEILFPGVGCFL 168 + C + VAGTT+NY LDDRINRAEILFPGV CFL Sbjct: 117 ISCSITVVAGTTMNYFLDDRINRAEILFPGVACFL 151 >ref|XP_002990718.1| hypothetical protein SELMODRAFT_236113 [Selaginella moellendorffii] gi|300141456|gb|EFJ08167.1| hypothetical protein SELMODRAFT_236113 [Selaginella moellendorffii] Length = 411 Score = 58.2 bits (139), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 64 MKCFVENVAGTTLNYSLDDRINRAEILFPGVGCFL 168 + C + VAGTT+NY LDDRINRAEILFPGV CFL Sbjct: 117 ISCSITVVAGTTMNYFLDDRINRAEILFPGVACFL 151 >ref|XP_001760240.1| predicted protein [Physcomitrella patens] gi|162688620|gb|EDQ74996.1| predicted protein [Physcomitrella patens] Length = 393 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 85 VAGTTLNYSLDDRINRAEILFPGVGCFL 168 VAGTT+NY LDDRINRAE+LFPGVGCFL Sbjct: 124 VAGTTMNYFLDDRINRAEVLFPGVGCFL 151