BLASTX nr result
ID: Rehmannia26_contig00028803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028803 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 71 2e-10 ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 gb|ESW10375.1| hypothetical protein PHAVU_009G203800g [Phaseolus... 61 1e-07 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 60 3e-07 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = -3 Query: 413 LSTALLTEPYVDVTAHTAPSQQAVSLPLQGMEVWMNRHQI---EEFFF 279 +S LLTEPYVDVTAHTAPSQQAVS PL+ MEVW+NRHQ FFF Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQTLVDRRFFF 53 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 333 RKANCLLAGSCMSGNVHVRLREKGGGQKW 419 RKANCLLAGSCMSGNVHVR REKGGGQKW Sbjct: 63 RKANCLLAGSCMSGNVHVRFREKGGGQKW 91 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +3 Query: 333 RKANCLLAGSCMSGNVHVRLREKGGGQKW 419 RKANCLLAGSCMSGNVHVR REKGGGQKW Sbjct: 1 RKANCLLAGSCMSGNVHVRFREKGGGQKW 29 >gb|ESW10375.1| hypothetical protein PHAVU_009G203800g [Phaseolus vulgaris] Length = 140 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 419 PFLSTALLTEPYVDVTAHTAPSQQAVSLPLQ 327 PFLSTALLTEPYVDVT HTAPS+QAVSLPLQ Sbjct: 15 PFLSTALLTEPYVDVTVHTAPSRQAVSLPLQ 45 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 333 RKANCLLAGSCMSGNVHVRLREKGGGQKW 419 R+A+CL AGSCMSGNVHVRLREKGGGQKW Sbjct: 24 READCLPAGSCMSGNVHVRLREKGGGQKW 52