BLASTX nr result
ID: Rehmannia26_contig00028598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028598 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469129.1| PREDICTED: seed biotin-containing protein SB... 60 4e-07 ref|XP_002325582.2| late embryogenesis abundant domain-containin... 58 1e-06 ref|XP_006371487.1| hypothetical protein POPTR_0019s12000g [Popu... 58 1e-06 dbj|BAF01507.1| seed maturation protein [Arabidopsis thaliana] 58 1e-06 gb|AAQ65102.1| At2g42560 [Arabidopsis thaliana] 58 1e-06 ref|NP_181784.1| late embryogenesis abundant domain-containing p... 58 1e-06 ref|XP_006446761.1| hypothetical protein CICLE_v10014817mg [Citr... 57 3e-06 ref|NP_001235522.1| seed biotin-containing protein SBP65 [Glycin... 56 4e-06 gb|ACS49840.1| seed biotinylated protein 68 kDa isoform [Glycine... 56 4e-06 >ref|XP_006469129.1| PREDICTED: seed biotin-containing protein SBP65-like [Citrus sinensis] Length = 546 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/70 (44%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEEQ---HISPRGHEKAHRQS 120 MASDQ RRE+ T E++ ++EKDRVPKM TH+E L+ +AKD + + G KA Sbjct: 1 MASDQARRETTTTEKEVVIEKDRVPKMTTHFESLTGRAKDSDTSGGKETSHGSGKARESH 60 Query: 119 EPSLEEISKL 90 E E L Sbjct: 61 EVGTHEFESL 70 >ref|XP_002325582.2| late embryogenesis abundant domain-containing family protein [Populus trichocarpa] gi|550317329|gb|EEE99963.2| late embryogenesis abundant domain-containing family protein [Populus trichocarpa] Length = 469 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDE--EQHISPRGHE 138 MAS+Q RRES T ER+ VE++RVPKMA+H+E L EK K+ E++I G+E Sbjct: 1 MASEQSRRESATSERENYVERERVPKMASHFESLIEKTKESVVEENIGEGGNE 53 >ref|XP_006371487.1| hypothetical protein POPTR_0019s12000g [Populus trichocarpa] gi|550317328|gb|ERP49284.1| hypothetical protein POPTR_0019s12000g [Populus trichocarpa] Length = 426 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDE--EQHISPRGHE 138 MAS+Q RRES T ER+ VE++RVPKMA+H+E L EK K+ E++I G+E Sbjct: 1 MASEQSRRESATSERENYVERERVPKMASHFESLIEKTKESVVEENIGEGGNE 53 >dbj|BAF01507.1| seed maturation protein [Arabidopsis thaliana] Length = 635 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEEQH 159 MAS+Q RRE+ ER+ VEKDRVPKM +H+E ++EK KD + H Sbjct: 1 MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKDSDTH 44 >gb|AAQ65102.1| At2g42560 [Arabidopsis thaliana] Length = 635 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEEQH 159 MAS+Q RRE+ ER+ VEKDRVPKM +H+E ++EK KD + H Sbjct: 1 MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKDSDTH 44 >ref|NP_181784.1| late embryogenesis abundant domain-containing protein [Arabidopsis thaliana] gi|4559335|gb|AAD22997.1| putative seed maturation protein [Arabidopsis thaliana] gi|330255045|gb|AEC10139.1| late embryogenesis abundant domain-containing protein [Arabidopsis thaliana] Length = 635 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEEQH 159 MAS+Q RRE+ ER+ VEKDRVPKM +H+E ++EK KD + H Sbjct: 1 MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKDSDTH 44 >ref|XP_006446761.1| hypothetical protein CICLE_v10014817mg [Citrus clementina] gi|557549372|gb|ESR60001.1| hypothetical protein CICLE_v10014817mg [Citrus clementina] Length = 546 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 290 MASDQLRRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEE 165 MASDQ RRE+ T +++ ++EKDRVPKM TH+E L+ +AKD + Sbjct: 1 MASDQARRETTTTKKEVVIEKDRVPKMTTHFESLTGRAKDSD 42 >ref|NP_001235522.1| seed biotin-containing protein SBP65 [Glycine max] gi|75102139|sp|Q39846.1|SBP65_SOYBN RecName: Full=Seed biotin-containing protein SBP65; AltName: Full=BP75; AltName: Full=Seed biotinylated protein of 65 kDa gi|1389897|gb|AAC61783.1| LEA protein [Glycine max] Length = 643 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/43 (62%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 290 MASDQL-RRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEE 165 MAS+QL RRE+ T E++ VEK RVPKMATH+EHL+E+AK+ + Sbjct: 1 MASEQLARRENTTTEKEIHVEKHRVPKMATHFEHLAEQAKESD 43 >gb|ACS49840.1| seed biotinylated protein 68 kDa isoform [Glycine max] Length = 643 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/43 (62%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 290 MASDQL-RRESVTEERDTMVEKDRVPKMATHYEHLSEKAKDEE 165 MAS+QL RRE+ T E++ VEK RVPKMATH+EHL+E+AK+ + Sbjct: 1 MASEQLARRENTTTEKEIHVEKHRVPKMATHFEHLAEQAKESD 43