BLASTX nr result
ID: Rehmannia26_contig00028582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028582 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485669.1| PREDICTED: tRNA dimethylallyltransferase 9-l... 58 2e-06 ref|XP_006451735.1| hypothetical protein CICLE_v10008222mg [Citr... 58 2e-06 ref|XP_006451734.1| hypothetical protein CICLE_v10008222mg [Citr... 58 2e-06 ref|XP_002300421.2| hypothetical protein POPTR_0001s38570g [Popu... 57 3e-06 >ref|XP_006485669.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Citrus sinensis] Length = 455 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 570 SLLKAYRTKNRHFISRDDCNGILDWVKRTQGE 475 S LK+YRT+NRHFISR DC ILDW+KRTQGE Sbjct: 414 SELKSYRTRNRHFISRGDCCNILDWIKRTQGE 445 >ref|XP_006451735.1| hypothetical protein CICLE_v10008222mg [Citrus clementina] gi|557554961|gb|ESR64975.1| hypothetical protein CICLE_v10008222mg [Citrus clementina] Length = 456 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 570 SLLKAYRTKNRHFISRDDCNGILDWVKRTQGE 475 S LK+YRT+NRHFISR DC ILDW+KRTQGE Sbjct: 415 SELKSYRTRNRHFISRGDCCNILDWIKRTQGE 446 >ref|XP_006451734.1| hypothetical protein CICLE_v10008222mg [Citrus clementina] gi|557554960|gb|ESR64974.1| hypothetical protein CICLE_v10008222mg [Citrus clementina] Length = 455 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 570 SLLKAYRTKNRHFISRDDCNGILDWVKRTQGE 475 S LK+YRT+NRHFISR DC ILDW+KRTQGE Sbjct: 414 SELKSYRTRNRHFISRGDCCNILDWIKRTQGE 445 >ref|XP_002300421.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa] gi|550349190|gb|EEE85226.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa] Length = 445 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 564 LKAYRTKNRHFISRDDCNGILDWVKRTQGE 475 LKAYRTKNRHF+SR+DC+ +LDW++ TQGE Sbjct: 411 LKAYRTKNRHFVSRNDCSDVLDWIRTTQGE 440