BLASTX nr result
ID: Rehmannia26_contig00028544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028544 (548 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527366.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_006338029.1| PREDICTED: crt homolog 3-like isoform X1 [So... 56 6e-06 >ref|XP_002527366.1| conserved hypothetical protein [Ricinus communis] gi|223533285|gb|EEF35038.1| conserved hypothetical protein [Ricinus communis] Length = 429 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/85 (38%), Positives = 45/85 (52%) Frame = +1 Query: 1 LPLLYIVINIAFNISVLNLLKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFF 180 LPLLYI+IN+AFNISVLNL+K FF Sbjct: 345 LPLLYIMINMAFNISVLNLVKLSSAVVSSLAVTLSVPISIYVLSLPLPYLPEGSGLSPFF 404 Query: 181 VLGSLVLMMGLIVYNVSWPLKQDSD 255 +LGS++L++GL++YNV+ P KQ S+ Sbjct: 405 LLGSMILVLGLVLYNVARPGKQASN 429 >ref|XP_006338029.1| PREDICTED: crt homolog 3-like isoform X1 [Solanum tuberosum] Length = 430 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/86 (38%), Positives = 42/86 (48%) Frame = +1 Query: 1 LPLLYIVINIAFNISVLNLLKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFF 180 LPLLYI NIAFNISVLNL+K FF Sbjct: 345 LPLLYIFTNIAFNISVLNLMKISSAVISSLVVMSSVPLSVYLLSMPLPYLPQGSSLSPFF 404 Query: 181 VLGSLVLMMGLIVYNVSWPLKQDSDI 258 +LGS VL++GLI+YN+ KQD+++ Sbjct: 405 LLGSAVLLIGLILYNIPRTQKQDTEL 430