BLASTX nr result
ID: Rehmannia26_contig00028385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00028385 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006392935.1| hypothetical protein EUTSA_v10011366mg [Eutr... 70 4e-10 ref|XP_006365004.1| PREDICTED: C-type lectin receptor-like tyros... 69 8e-10 ref|XP_006365003.1| PREDICTED: C-type lectin receptor-like tyros... 69 8e-10 tpg|DAA53871.1| TPA: putative protein kinase superfamily protein... 69 8e-10 tpg|DAA53869.1| TPA: putative protein kinase superfamily protein... 69 8e-10 ref|NP_001170516.1| uncharacterized protein LOC100384527 [Zea ma... 69 8e-10 gb|EPS72271.1| hypothetical protein M569_02485, partial [Genlise... 68 1e-09 ref|XP_004967926.1| PREDICTED: C-type lectin receptor-like tyros... 68 1e-09 ref|XP_004967925.1| PREDICTED: C-type lectin receptor-like tyros... 68 1e-09 ref|XP_004967924.1| PREDICTED: C-type lectin receptor-like tyros... 68 1e-09 ref|XP_004488122.1| PREDICTED: C-type lectin receptor-like tyros... 68 1e-09 ref|XP_006307159.1| hypothetical protein CARUB_v10008750mg [Caps... 68 1e-09 ref|NP_175641.1| C-type lectin receptor-like tyrosine-protein ki... 68 1e-09 ref|XP_002891685.1| kinase family protein [Arabidopsis lyrata su... 68 1e-09 ref|XP_004294706.1| PREDICTED: C-type lectin receptor-like tyros... 68 1e-09 gb|EMJ05392.1| hypothetical protein PRUPE_ppa003719mg [Prunus pe... 68 1e-09 ref|XP_006643639.1| PREDICTED: C-type lectin receptor-like tyros... 67 2e-09 ref|XP_006643638.1| PREDICTED: C-type lectin receptor-like tyros... 67 2e-09 gb|EMT27640.1| Phytosulfokine receptor 2 [Aegilops tauschii] 67 2e-09 ref|XP_004233271.1| PREDICTED: C-type lectin receptor-like tyros... 67 2e-09 >ref|XP_006392935.1| hypothetical protein EUTSA_v10011366mg [Eutrema salsugineum] gi|557089513|gb|ESQ30221.1| hypothetical protein EUTSA_v10011366mg [Eutrema salsugineum] Length = 552 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDEDFGAHLMGV Sbjct: 380 FLHDKVKPQVVHRDIRASNVLLDEDFGAHLMGV 412 >ref|XP_006365004.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X2 [Solanum tuberosum] Length = 550 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDK+KPQVVHRDIRA+NVLLDEDFGAHLMGV Sbjct: 376 FLHDKMKPQVVHRDIRASNVLLDEDFGAHLMGV 408 >ref|XP_006365003.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X1 [Solanum tuberosum] Length = 551 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDK+KPQVVHRDIRA+NVLLDEDFGAHLMGV Sbjct: 377 FLHDKMKPQVVHRDIRASNVLLDEDFGAHLMGV 409 >tpg|DAA53871.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 511 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDEDFG+HLMGV Sbjct: 318 FLHDKVKPQVVHRDIRASNVLLDEDFGSHLMGV 350 >tpg|DAA53869.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea mays] gi|414876739|tpg|DAA53870.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea mays] Length = 555 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDEDFG+HLMGV Sbjct: 362 FLHDKVKPQVVHRDIRASNVLLDEDFGSHLMGV 394 >ref|NP_001170516.1| uncharacterized protein LOC100384527 [Zea mays] gi|238005804|gb|ACR33937.1| unknown [Zea mays] Length = 208 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDEDFG+HLMGV Sbjct: 15 FLHDKVKPQVVHRDIRASNVLLDEDFGSHLMGV 47 >gb|EPS72271.1| hypothetical protein M569_02485, partial [Genlisea aurea] Length = 489 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA NVLLDED+GAHLMGV Sbjct: 321 FLHDKVKPQVVHRDIRAANVLLDEDYGAHLMGV 353 >ref|XP_004967926.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X3 [Setaria italica] Length = 554 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 361 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 393 >ref|XP_004967925.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X2 [Setaria italica] Length = 554 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 361 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 393 >ref|XP_004967924.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X1 [Setaria italica] Length = 555 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 362 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 394 >ref|XP_004488122.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Cicer arietinum] Length = 548 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 375 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 407 >ref|XP_006307159.1| hypothetical protein CARUB_v10008750mg [Capsella rubella] gi|565499042|ref|XP_006307160.1| hypothetical protein CARUB_v10008750mg [Capsella rubella] gi|482575870|gb|EOA40057.1| hypothetical protein CARUB_v10008750mg [Capsella rubella] gi|482575871|gb|EOA40058.1| hypothetical protein CARUB_v10008750mg [Capsella rubella] Length = 554 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 383 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 415 >ref|NP_175641.1| C-type lectin receptor-like tyrosine-protein kinase [Arabidopsis thaliana] gi|75333494|sp|Q9C823.1|Y1523_ARATH RecName: Full=C-type lectin receptor-like tyrosine-protein kinase At1g52310; Flags: Precursor gi|12323127|gb|AAG51547.1|AC037424_12 protein kinase, putative; 54672-52611 [Arabidopsis thaliana] gi|17065350|gb|AAL32829.1| protein kinase, putative [Arabidopsis thaliana] gi|31711972|gb|AAP68342.1| At1g52310 [Arabidopsis thaliana] gi|332194659|gb|AEE32780.1| C-type lectin receptor-like tyrosine-protein kinase [Arabidopsis thaliana] Length = 552 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 381 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 413 >ref|XP_002891685.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337527|gb|EFH67944.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 552 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 381 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGV 413 >ref|XP_004294706.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Fragaria vesca subsp. vesca] Length = 545 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKP VVHRDIRA+NVLLDEDFGAHLMGV Sbjct: 372 FLHDKVKPHVVHRDIRASNVLLDEDFGAHLMGV 404 >gb|EMJ05392.1| hypothetical protein PRUPE_ppa003719mg [Prunus persica] Length = 553 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKP VVHRDIRA+NVLLDEDFGAHLMGV Sbjct: 380 FLHDKVKPHVVHRDIRASNVLLDEDFGAHLMGV 412 >ref|XP_006643639.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X2 [Oryza brachyantha] Length = 544 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FG+HLMGV Sbjct: 353 FLHDKVKPQVVHRDIRASNVLLDEEFGSHLMGV 385 >ref|XP_006643638.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like isoform X1 [Oryza brachyantha] Length = 545 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FG+HLMGV Sbjct: 354 FLHDKVKPQVVHRDIRASNVLLDEEFGSHLMGV 386 >gb|EMT27640.1| Phytosulfokine receptor 2 [Aegilops tauschii] Length = 551 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDKVKPQVVHRDIRA+NVLLDE+FG+HLMGV Sbjct: 359 FLHDKVKPQVVHRDIRASNVLLDEEFGSHLMGV 391 >ref|XP_004233271.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310-like [Solanum lycopersicum] Length = 545 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 232 FLHDKVKPQVVHRDIRATNVLLDEDFGAHLMGV 330 FLHDK+KPQVVHRDIRA+NVLLDE+FGAHLMGV Sbjct: 371 FLHDKMKPQVVHRDIRASNVLLDEEFGAHLMGV 403