BLASTX nr result
ID: Rehmannia26_contig00026981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026981 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519616.1| conserved hypothetical protein [Ricinus comm... 65 9e-09 >ref|XP_002519616.1| conserved hypothetical protein [Ricinus communis] gi|223541206|gb|EEF42761.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/72 (45%), Positives = 47/72 (65%) Frame = +1 Query: 55 IYQENNIDDDFQVGLDEVQSLNRDDMDPEDIEDLVIENLPEVVEAANLEEVDEENEFDDT 234 +YQEN I+D V L E+ SLNR D+D +D+ +I L E + N+ +VDE +E DDT Sbjct: 68 VYQENEINDIVIVDLSEIASLNRVDIDLKDVNSFIISELHEGSKDENIIDVDEFDETDDT 127 Query: 235 VVDYYSSEEHSQ 270 +VDY +S+E Q Sbjct: 128 LVDYCTSDEDIQ 139