BLASTX nr result
ID: Rehmannia26_contig00026823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026823 (508 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Mo... 97 2e-18 ref|XP_006649397.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-depen... 97 2e-18 ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulato... 97 2e-18 gb|EOY33668.1| Cyclin-dependent kinases regulatory subunit 1 [Th... 97 2e-18 ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulato... 97 2e-18 ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit ... 97 2e-18 ref|XP_002468510.1| hypothetical protein SORBIDRAFT_01g047130 [S... 97 2e-18 ref|NP_001147261.1| cyclin-dependent kinases regulatory subunit ... 97 2e-18 gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Came... 97 2e-18 dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 97 2e-18 ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit ... 97 2e-18 ref|NP_001048957.1| Os03g0146300 [Oryza sativa Japonica Group] g... 97 2e-18 ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulato... 96 4e-18 ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulato... 96 4e-18 ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit,... 96 4e-18 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 96 5e-18 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 96 5e-18 gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] 96 5e-18 ref|XP_006662593.1| PREDICTED: uncharacterized protein LOC102717... 95 8e-18 ref|XP_003562090.1| PREDICTED: uncharacterized protein LOC100840... 95 8e-18 >gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_006649397.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinases regulatory subunit 1-like [Oryza brachyantha] Length = 94 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Setaria italica] Length = 90 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >gb|EOY33668.1| Cyclin-dependent kinases regulatory subunit 1 [Theobroma cacao] Length = 88 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Cicer arietinum] Length = 88 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|355507367|gb|AES88509.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|388496380|gb|AFK36256.1| unknown [Medicago truncatula] Length = 88 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_002468510.1| hypothetical protein SORBIDRAFT_01g047130 [Sorghum bicolor] gi|241922364|gb|EER95508.1| hypothetical protein SORBIDRAFT_01g047130 [Sorghum bicolor] Length = 87 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|NP_001147261.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|194702034|gb|ACF85101.1| unknown [Zea mays] gi|195604506|gb|ACG24083.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195606852|gb|ACG25256.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608282|gb|ACG25971.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608534|gb|ACG26097.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608568|gb|ACG26114.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608768|gb|ACG26214.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608806|gb|ACG26233.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608824|gb|ACG26242.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609230|gb|ACG26445.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609378|gb|ACG26519.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609486|gb|ACG26573.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610092|gb|ACG26876.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610384|gb|ACG27022.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610444|gb|ACG27052.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610678|gb|ACG27169.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195617154|gb|ACG30407.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195617600|gb|ACG30630.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195639798|gb|ACG39367.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|413957008|gb|AFW89657.1| hypothetical protein ZEAMMB73_443898 [Zea mays] Length = 87 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Camellia sinensis] Length = 88 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 448 LSYRVNCLKIMGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 +S+RV ++ MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1195 VSFRVIAVE-MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 1248 >ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|356542684|ref|XP_003539796.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Glycine max] gi|571486483|ref|XP_006590361.1| PREDICTED: cyclin-dependent kinases regulatory subunit isoform X1 [Glycine max] gi|42362268|gb|AAS13367.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|255628843|gb|ACU14766.1| unknown [Glycine max] gi|388501782|gb|AFK38957.1| unknown [Lotus japonicus] gi|561005345|gb|ESW04339.1| hypothetical protein PHAVU_011G086900g [Phaseolus vulgaris] Length = 88 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|NP_001048957.1| Os03g0146300 [Oryza sativa Japonica Group] gi|75127295|sp|Q6PS57.1|CKS1_ORYSJ RecName: Full=Cyclin-dependent kinases regulatory subunit 1 gi|158512867|sp|A2XCH8.1|CKS1_ORYSI RecName: Full=Cyclin-dependent kinases regulatory subunit 1 gi|15451612|gb|AAK98736.1|AC090485_15 Putative cyclin-dependent kinase regulatory subunit [Oryza sativa Japonica Group] gi|46487749|gb|AAS99236.1| cyclin-dependent kinase subunit [Oryza sativa Japonica Group] gi|108706167|gb|ABF93962.1| cyclin-dependent kinases regulatory subunit, putative, expressed [Oryza sativa Japonica Group] gi|113547428|dbj|BAF10871.1| Os03g0146300 [Oryza sativa Japonica Group] gi|125542399|gb|EAY88538.1| hypothetical protein OsI_10011 [Oryza sativa Indica Group] gi|125584911|gb|EAZ25575.1| hypothetical protein OsJ_09400 [Oryza sativa Japonica Group] gi|215768237|dbj|BAH00466.1| unnamed protein product [Oryza sativa Japonica Group] Length = 90 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Fragaria vesca subsp. vesca] Length = 85 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPPEV+KLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVSKLLPKNRLLSENEWRAIG 45 >ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Solanum lycopersicum] gi|565364675|ref|XP_006349044.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Solanum tuberosum] Length = 88 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDTYEYRHVVLPP+VAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSENEWRAIG 45 >ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKY+DDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYYDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] Length = 88 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 45 >ref|XP_006662593.1| PREDICTED: uncharacterized protein LOC102717468 [Oryza brachyantha] Length = 263 Score = 95.1 bits (235), Expect = 8e-18 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -1 Query: 418 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIG 284 MGQIQYS+KYFDDTYEYRHVVLPP+VAKLLPKNRLLSENEWRAIG Sbjct: 1 MGQIQYSDKYFDDTYEYRHVVLPPDVAKLLPKNRLLSENEWRAIG 45 >ref|XP_003562090.1| PREDICTED: uncharacterized protein LOC100840494 [Brachypodium distachyon] Length = 184 Score = 95.1 bits (235), Expect = 8e-18 Identities = 48/62 (77%), Positives = 52/62 (83%) Frame = -1 Query: 469 SPRLNSELSYRVNCLKIMGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRA 290 S RL+ EL L MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLL+ENEWRA Sbjct: 84 SKRLDREL------LVEMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLAENEWRA 137 Query: 289 IG 284 +G Sbjct: 138 LG 139