BLASTX nr result
ID: Rehmannia26_contig00025719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00025719 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517768.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002517768.1| conserved hypothetical protein [Ricinus communis] gi|223543040|gb|EEF44575.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 139 YNYALVNPNGNNPFVQFVQSTESTIERVIFDFRF 38 +NYA NP+G++P VQFV+STES IER+IFDFRF Sbjct: 81 FNYAFANPSGSSPVVQFVRSTESNIERIIFDFRF 114