BLASTX nr result
ID: Rehmannia26_contig00025361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00025361 (509 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242880.1| PREDICTED: F-box protein At5g07610-like [Sol... 55 7e-06 >ref|XP_004242880.1| PREDICTED: F-box protein At5g07610-like [Solanum lycopersicum] Length = 439 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 110 IAYNDDLLTEILIWLPEKSLIRFKLVCKRWFSLIS 214 +A N DLL+EIL+WLP KSL+RF+ VCK WFS+IS Sbjct: 52 VAGNADLLSEILLWLPPKSLLRFQAVCKDWFSIIS 86