BLASTX nr result
ID: Rehmannia26_contig00024765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00024765 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631561.1| PREDICTED: probable serine/threonine-protein... 55 9e-06 ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein... 55 9e-06 emb|CBI37741.3| unnamed protein product [Vitis vinifera] 55 9e-06 >ref|XP_003631561.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like isoform 2 [Vitis vinifera] Length = 417 Score = 55.1 bits (131), Expect = 9e-06 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -1 Query: 308 FSGKSKLLVANIGSAEASPSPTAGLMLAHPNLRIFSFSELKAATRNF*NDTVV 150 FS S+ A+ GS EA P+ G +L HPNLRIF+FSELKAAT+NF DTV+ Sbjct: 42 FSRNSQFSAASGGSDEAFPN---GQILPHPNLRIFTFSELKAATKNFRPDTVL 91 >ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like isoform 1 [Vitis vinifera] Length = 415 Score = 55.1 bits (131), Expect = 9e-06 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -1 Query: 308 FSGKSKLLVANIGSAEASPSPTAGLMLAHPNLRIFSFSELKAATRNF*NDTVV 150 FS S+ A+ GS EA P+ G +L HPNLRIF+FSELKAAT+NF DTV+ Sbjct: 40 FSRNSQFSAASGGSDEAFPN---GQILPHPNLRIFTFSELKAATKNFRPDTVL 89 >emb|CBI37741.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 55.1 bits (131), Expect = 9e-06 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -1 Query: 308 FSGKSKLLVANIGSAEASPSPTAGLMLAHPNLRIFSFSELKAATRNF*NDTVV 150 FS S+ A+ GS EA P+ G +L HPNLRIF+FSELKAAT+NF DTV+ Sbjct: 40 FSRNSQFSAASGGSDEAFPN---GQILPHPNLRIFTFSELKAATKNFRPDTVL 89