BLASTX nr result
ID: Rehmannia26_contig00024334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00024334 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73969.1| hypothetical protein M569_00788 [Genlisea aurea] 57 3e-06 >gb|EPS73969.1| hypothetical protein M569_00788 [Genlisea aurea] Length = 101 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 4/105 (3%) Frame = -3 Query: 424 MESRLTKLEIDAVLQLIQLSGNSTDDFRVFWLNFPAXXXXXXXXXXXKSAGESLSSSLID 245 M+S L+ EI A+LQLI+L + + A S ES SSS+I+ Sbjct: 1 MDSTLSNREIAAILQLIELRRSVITPAK------KAAKEVVEEEQVRISDDESSSSSIIN 54 Query: 244 PE---NCSADEALPRRKMKFGSVVDIYRKTDQPLIKNRA-KKRPR 122 PE N S D+ LPR +FGS+++IYR+T+ P + + + KK+PR Sbjct: 55 PEKERNSSNDDCLPRINQRFGSLIEIYRRTEPPPVGSPSPKKKPR 99