BLASTX nr result
ID: Rehmannia26_contig00024208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00024208 (544 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28035.1| hypothetical protein L484_022268 [Morus notabilis] 61 2e-07 gb|EOY19411.1| Tetratricopeptide repeat-like superfamily protein... 58 1e-06 ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] 58 2e-06 ref|XP_004248773.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citr... 57 3e-06 ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Popu... 57 4e-06 ref|XP_002512558.1| pentatricopeptide repeat-containing protein,... 56 5e-06 >gb|EXC28035.1| hypothetical protein L484_022268 [Morus notabilis] Length = 540 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 118 LPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 LP L S+DADS+ ++L+RHHNPFH MESSLQL+G++LS Sbjct: 58 LPSLEPSNDADSISEILVRHHNPFHAMESSLQLHGLSLS 96 >gb|EOY19411.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 612 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 121 SLPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 +LP L S +ADSL Q+L+ HHNPFH MESS+QL+GI+LS Sbjct: 117 NLPKLQPSEEADSLSQLLLAHHNPFHSMESSIQLHGISLS 156 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/53 (54%), Positives = 34/53 (64%) Frame = -1 Query: 160 SPSPAPCQSVGKPSLPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 S P P LP L S DAD + ++L++HHNPFH MESSLQL GIALS Sbjct: 30 SSIPQPPDDALSTGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGIALS 82 >emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] Length = 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/53 (54%), Positives = 34/53 (64%) Frame = -1 Query: 160 SPSPAPCQSVGKPSLPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 S P P LP L S DAD + ++L++HHNPFH MESSLQL GIALS Sbjct: 30 SSIPQPPDDALSTGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGIALS 82 >ref|XP_004248773.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] Length = 532 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/83 (40%), Positives = 48/83 (57%) Frame = -1 Query: 250 LAHFLRPRLTFAKPTLQFILYHSFSDTEELSPSPAPCQSVGKPSLPPLHHSSDADSLCQV 71 LA F L F K ++F+ + S +L +P P LP S+DAD + Q+ Sbjct: 13 LARFDFRSLFFPKLRVRFLRFFCSS---QLQQTP--------PELPQFEPSNDADLISQL 61 Query: 70 LIRHHNPFHHMESSLQLYGIALS 2 L++HHNPFH MESSLQL+GI+ + Sbjct: 62 LLQHHNPFHAMESSLQLHGISFT 84 >ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|567879147|ref|XP_006432132.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|568821248|ref|XP_006465094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Citrus sinensis] gi|568821250|ref|XP_006465095.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Citrus sinensis] gi|557534253|gb|ESR45371.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|557534254|gb|ESR45372.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] Length = 540 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 118 LPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 LP L S+DAD L Q+++ HHNPFH MESSLQL+GI LS Sbjct: 48 LPKLEPSNDADLLSQIVLAHHNPFHAMESSLQLHGITLS 86 >ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] gi|550338280|gb|EEE93261.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] Length = 548 Score = 56.6 bits (135), Expect = 4e-06 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -1 Query: 187 HSFS-DTEELSPSPAPCQSVGKPSLPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGI 11 H+FS D + SP LP L S+DAD L Q+L+ HHNPFH MESSLQL GI Sbjct: 31 HNFSSDNDAFSPR-------NDTLLPTLQPSNDADLLSQILLHHHNPFHAMESSLQLPGI 83 Query: 10 ALS 2 +L+ Sbjct: 84 SLT 86 >ref|XP_002512558.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548519|gb|EEF50010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 511 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 121 SLPPLHHSSDADSLCQVLIRHHNPFHHMESSLQLYGIALS 2 SLP L S+DA+ + ++L+ HHNPFH MESSLQL+GI LS Sbjct: 29 SLPSLEPSNDAEIVSEILLNHHNPFHAMESSLQLHGITLS 68