BLASTX nr result
ID: Rehmannia26_contig00024195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00024195 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313587.2| hypothetical protein POPTR_0009s16740g [Popu... 109 8e-35 ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 112 1e-34 ref|XP_002328126.1| predicted protein [Populus trichocarpa] 111 1e-33 ref|XP_006384837.1| hypothetical protein POPTR_0004s21490g [Popu... 111 1e-33 ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 1... 111 3e-33 ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citr... 111 3e-33 emb|CBI37755.3| unnamed protein product [Vitis vinifera] 103 1e-32 ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 1... 103 1e-32 gb|EMJ00934.1| hypothetical protein PRUPE_ppa002658mg [Prunus pe... 107 5e-32 ref|XP_006473917.1| PREDICTED: U-box domain-containing protein 1... 100 2e-30 ref|XP_006435360.1| hypothetical protein CICLE_v10003715mg [Citr... 100 2e-30 ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 1... 100 2e-29 ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 1... 100 2e-29 emb|CAN75366.1| hypothetical protein VITISV_030646 [Vitis vinifera] 97 2e-28 emb|CBI19855.3| unnamed protein product [Vitis vinifera] 97 2e-28 ref|XP_002280063.2| PREDICTED: U-box domain-containing protein 1... 97 2e-28 gb|EOY15258.1| Plant U-Box 15, putative [Theobroma cacao] 97 8e-28 ref|XP_006282265.1| hypothetical protein CARUB_v10028542mg [Caps... 101 2e-27 ref|NP_199049.2| U-box domain-containing protein 15 [Arabidopsis... 102 2e-27 dbj|BAD43348.1| arm repeat containing protein [Arabidopsis thali... 102 2e-27 >ref|XP_002313587.2| hypothetical protein POPTR_0009s16740g [Populus trichocarpa] gi|550331877|gb|EEE87542.2| hypothetical protein POPTR_0009s16740g [Populus trichocarpa] Length = 644 Score = 109 bits (272), Expect(2) = 8e-35 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WLNS HRTCPKTGQ L +L++A NFALRNLI +WCEKNNYELPKK Sbjct: 289 VATGQTYERESIQKWLNSNHRTCPKTGQTLGHLSLASNFALRNLIQEWCEKNNYELPKK 347 Score = 63.5 bits (153), Expect(2) = 8e-35 Identities = 34/57 (59%), Positives = 42/57 (73%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G ++QQ+ DLL KFKQIAG+DE VLDGP + L++ RSLLIPHEF Sbjct: 218 KLVKERGVQNAESMQQINDLLGKFKQIAGVDETIVLDGPFSSKSLQRCRSLLIPHEF 274 >ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223534885|gb|EEF36572.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 655 Score = 112 bits (281), Expect(2) = 1e-34 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESI+RWLNS HRTCPKTGQ L++L++APNFALRNLI+QWCEKNN+ELPK+ Sbjct: 300 VATGQTYERESIKRWLNSNHRTCPKTGQMLDHLSLAPNFALRNLILQWCEKNNFELPKR 358 Score = 59.7 bits (143), Expect(2) = 1e-34 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 330 AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 +IQQ+ DLL KFKQIAG+ EN LDGP + L K +SL+IPHEF Sbjct: 241 SIQQITDLLGKFKQIAGVHENIELDGPVSSKTLHKCQSLIIPHEF 285 >ref|XP_002328126.1| predicted protein [Populus trichocarpa] Length = 615 Score = 111 bits (277), Expect(2) = 1e-33 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +A+GQTYERESIQ+WLNS HRTCPKTGQ L++L++APNFALRNLI+QWCEKN YELPKK Sbjct: 265 VASGQTYERESIQKWLNSNHRTCPKTGQILDHLSLAPNFALRNLILQWCEKNKYELPKK 323 Score = 57.8 bits (138), Expect(2) = 1e-33 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G +IQQ+ D L KF+ IAG+DE LDGP + L+K +SLLIPHEF Sbjct: 194 KLVKQRGVQNAESIQQIKDFLGKFRHIAGVDETIDLDGPISSKSLQKCQSLLIPHEF 250 >ref|XP_006384837.1| hypothetical protein POPTR_0004s21490g [Populus trichocarpa] gi|550341605|gb|ERP62634.1| hypothetical protein POPTR_0004s21490g [Populus trichocarpa] Length = 614 Score = 111 bits (277), Expect(2) = 1e-33 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +A+GQTYERESIQ+WLNS HRTCPKTGQ L++L++APNFALRNLI+QWCEKN YELPKK Sbjct: 259 VASGQTYERESIQKWLNSNHRTCPKTGQILDHLSLAPNFALRNLILQWCEKNKYELPKK 317 Score = 57.8 bits (138), Expect(2) = 1e-33 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G +IQQ+ D L KF+ IAG+DE LDGP + L+K +SLLIPHEF Sbjct: 188 KLVKQRGVQNAESIQQIKDFLGKFRHIAGVDETIDLDGPISSKSLQKCQSLLIPHEF 244 >ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 15-like [Citrus sinensis] Length = 643 Score = 111 bits (277), Expect(2) = 3e-33 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQRWLNS H+TCPKTGQ L++L++APN+ALRNLI+QWCEKNN ELPKK Sbjct: 288 VATGQTYERESIQRWLNSNHKTCPKTGQILDHLSLAPNYALRNLIVQWCEKNNVELPKK 346 Score = 56.6 bits (135), Expect(2) = 3e-33 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKG---KCAIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G +I Q+ DLL KFKQIAG+++ VLDG R L++ +++L+PHEF Sbjct: 217 KLVKERGGHKADSISQITDLLGKFKQIAGVEDTLVLDGSVSARKLQRCQTMLVPHEF 273 >ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] gi|557524373|gb|ESR35679.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] Length = 643 Score = 111 bits (277), Expect(2) = 3e-33 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQRWLNS H+TCPKTGQ L++L++APN+ALRNLI+QWCEKNN ELPKK Sbjct: 288 VATGQTYERESIQRWLNSNHKTCPKTGQILDHLSLAPNYALRNLIVQWCEKNNVELPKK 346 Score = 56.6 bits (135), Expect(2) = 3e-33 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKG---KCAIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G +I Q+ DLL KFKQIAG+++ VLDG R L++ +++L+PHEF Sbjct: 217 KLVKERGGHKADSISQITDLLGKFKQIAGVEDTLVLDGSVSARKLQRCQTMLVPHEF 273 >emb|CBI37755.3| unnamed protein product [Vitis vinifera] Length = 677 Score = 103 bits (258), Expect(2) = 1e-32 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WL+S H TCPKTGQ L +L++APN+ALRNLI+QWCEKN +ELP+K Sbjct: 279 VATGQTYERESIQKWLDSDHHTCPKTGQTLVHLSLAPNYALRNLILQWCEKNQFELPRK 337 Score = 62.0 bits (149), Expect(2) = 1e-32 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK + A QQ+V+LL KFK++AG++E+SVLDGP L R L+K SL+IPHEF Sbjct: 208 KLVKERAGLSAEASQQIVELLGKFKKLAGMEESSVLDGPVLSRNLQKCPSLVIPHEF 264 >ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 15 [Vitis vinifera] Length = 641 Score = 103 bits (258), Expect(2) = 1e-32 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WL+S H TCPKTGQ L +L++APN+ALRNLI+QWCEKN +ELP+K Sbjct: 279 VATGQTYERESIQKWLDSDHHTCPKTGQTLVHLSLAPNYALRNLILQWCEKNQFELPRK 337 Score = 62.0 bits (149), Expect(2) = 1e-32 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK + A QQ+V+LL KFK++AG++E+SVLDGP L R L+K SL+IPHEF Sbjct: 208 KLVKERAGLSAEASQQIVELLGKFKKLAGMEESSVLDGPVLSRNLQKCPSLVIPHEF 264 >gb|EMJ00934.1| hypothetical protein PRUPE_ppa002658mg [Prunus persica] Length = 647 Score = 107 bits (266), Expect(2) = 5e-32 Identities = 45/59 (76%), Positives = 56/59 (94%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYER SI++WL+S HRTCPKTGQ L++L++APNFAL+NLI+QWCEKNN+ELPKK Sbjct: 292 VATGQTYERVSIKKWLDSNHRTCPKTGQTLDHLSLAPNFALKNLILQWCEKNNFELPKK 350 Score = 56.6 bits (135), Expect(2) = 5e-32 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 330 AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 +IQQ+ DLL KFK+IAGI E+ LDGP R K +SLLIPHEF Sbjct: 233 SIQQITDLLGKFKEIAGIYEDFFLDGPVSTRSPRKCQSLLIPHEF 277 >ref|XP_006473917.1| PREDICTED: U-box domain-containing protein 15-like [Citrus sinensis] Length = 643 Score = 100 bits (249), Expect(2) = 2e-30 Identities = 41/59 (69%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 IA+GQT+ERES+Q+W +S HRTCPKT Q L +L++APN+AL+NLI+QWCEKNN++LPKK Sbjct: 290 IASGQTFERESVQKWFDSNHRTCPKTRQTLAHLSIAPNYALKNLILQWCEKNNFKLPKK 348 Score = 57.8 bits (138), Expect(2) = 2e-30 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = -1 Query: 354 LVKAKGKCA---IQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 LVK +G + IQQ++DLL KFKQ+AG++ +VLD P + + L KS SL+IPHEF Sbjct: 220 LVKERGSQSSESIQQMIDLLNKFKQVAGMEITNVLDDPIVPKMLGKSLSLVIPHEF 275 >ref|XP_006435360.1| hypothetical protein CICLE_v10003715mg [Citrus clementina] gi|557537482|gb|ESR48600.1| hypothetical protein CICLE_v10003715mg [Citrus clementina] Length = 643 Score = 100 bits (249), Expect(2) = 2e-30 Identities = 41/59 (69%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 IA+GQT+ERES+Q+W +S HRTCPKT Q L +L++APN+AL+NLI+QWCEKNN++LPKK Sbjct: 290 IASGQTFERESVQKWFDSNHRTCPKTRQTLAHLSIAPNYALKNLILQWCEKNNFKLPKK 348 Score = 57.8 bits (138), Expect(2) = 2e-30 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = -1 Query: 354 LVKAKGKCA---IQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 LVK +G + IQQ++DLL KFKQ+AG++ +VLD P + + L KS SL+IPHEF Sbjct: 220 LVKERGSQSSESIQQMIDLLNKFKQVAGMEITNVLDDPIVPKMLGKSLSLVIPHEF 275 >ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 650 Score = 100 bits (250), Expect(2) = 2e-29 Identities = 42/59 (71%), Positives = 53/59 (89%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYER SIQ+WL S H TCPKTGQ L+++++APNF+L+NLI QWCEKN++ELPKK Sbjct: 295 VATGQTYERASIQKWLGSNHNTCPKTGQTLDHISLAPNFSLKNLIQQWCEKNHFELPKK 353 Score = 53.9 bits (128), Expect(2) = 2e-29 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 330 AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 +IQQV DLL +FK+ AGI E+ +LDGP + L K RSLLIP+EF Sbjct: 236 SIQQVTDLLGRFKENAGIYEDFLLDGPVSTKSLRKYRSLLIPNEF 280 >ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 625 Score = 100 bits (250), Expect(2) = 2e-29 Identities = 42/59 (71%), Positives = 53/59 (89%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYER SIQ+WL S H TCPKTGQ L+++++APNF+L+NLI QWCEKN++ELPKK Sbjct: 295 VATGQTYERASIQKWLGSNHNTCPKTGQTLDHISLAPNFSLKNLIQQWCEKNHFELPKK 353 Score = 53.9 bits (128), Expect(2) = 2e-29 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 330 AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 +IQQV DLL +FK+ AGI E+ +LDGP + L K RSLLIP+EF Sbjct: 236 SIQQVTDLLGRFKENAGIYEDFLLDGPVSTKSLRKYRSLLIPNEF 280 >emb|CAN75366.1| hypothetical protein VITISV_030646 [Vitis vinifera] Length = 1049 Score = 97.4 bits (241), Expect(2) = 2e-28 Identities = 40/59 (67%), Positives = 52/59 (88%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WL+S H+TCPKT Q L + ++ PN+ALRNLI+QWCE NN+++PKK Sbjct: 295 VATGQTYERESIQKWLDSNHKTCPKTMQPLVHSSLVPNYALRNLILQWCENNNFQIPKK 353 Score = 54.3 bits (129), Expect(2) = 2e-28 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G + Q V++LL KF+Q G++E +VLD P + + LEKS SL IPHEF Sbjct: 224 KLVKERGGQNAESTQHVIELLNKFRQSGGLEEINVLDDPIVPKTLEKSPSLAIPHEF 280 >emb|CBI19855.3| unnamed protein product [Vitis vinifera] Length = 684 Score = 97.4 bits (241), Expect(2) = 2e-28 Identities = 40/59 (67%), Positives = 52/59 (88%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WL+S H+TCPKT Q L + ++ PN+ALRNLI+QWCE NN+++PKK Sbjct: 295 VATGQTYERESIQKWLDSNHKTCPKTMQPLVHSSLVPNYALRNLILQWCENNNFQIPKK 353 Score = 54.3 bits (129), Expect(2) = 2e-28 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G + Q V++LL KF+Q G++E +VLD P + + LEKS SL IPHEF Sbjct: 224 KLVKERGGQNAESTQHVIELLNKFRQSGGLEEINVLDDPIVPKTLEKSPSLAIPHEF 280 >ref|XP_002280063.2| PREDICTED: U-box domain-containing protein 15-like [Vitis vinifera] Length = 649 Score = 97.4 bits (241), Expect(2) = 2e-28 Identities = 40/59 (67%), Positives = 52/59 (88%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +ATGQTYERESIQ+WL+S H+TCPKT Q L + ++ PN+ALRNLI+QWCE NN+++PKK Sbjct: 295 VATGQTYERESIQKWLDSNHKTCPKTMQPLVHSSLVPNYALRNLILQWCENNNFQIPKK 353 Score = 54.3 bits (129), Expect(2) = 2e-28 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 357 KLVKAKGKC---AIQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 KLVK +G + Q V++LL KF+Q G++E +VLD P + + LEKS SL IPHEF Sbjct: 224 KLVKERGGQNAESTQHVIELLNKFRQSGGLEEINVLDDPIVPKTLEKSPSLAIPHEF 280 >gb|EOY15258.1| Plant U-Box 15, putative [Theobroma cacao] Length = 651 Score = 97.4 bits (241), Expect(2) = 8e-28 Identities = 39/59 (66%), Positives = 54/59 (91%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 +A+GQT+ERESIQ+W +S HRTCPKT Q L++L++APN+AL+NLI +WCEKNN+++PKK Sbjct: 296 VASGQTFERESIQKWFDSNHRTCPKTRQTLDHLSLAPNYALKNLITEWCEKNNFKVPKK 354 Score = 52.0 bits (123), Expect(2) = 8e-28 Identities = 25/55 (45%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -1 Query: 354 LVKAKGKCA--IQQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 L K +G+ + QQ+++LL KFKQI G++ ++LD P + + L KS+SL+IP EF Sbjct: 227 LAKERGQTSESTQQIIELLNKFKQILGMEVTNILDDPVMPKMLVKSQSLIIPPEF 281 >ref|XP_006282265.1| hypothetical protein CARUB_v10028542mg [Capsella rubella] gi|482550969|gb|EOA15163.1| hypothetical protein CARUB_v10028542mg [Capsella rubella] Length = 665 Score = 101 bits (251), Expect(2) = 2e-27 Identities = 41/59 (69%), Positives = 55/59 (93%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 IATGQTYE++SIQ+W + GH+TCPKT Q+L +L++APNFAL+NLI+QWCEKNN++LP+K Sbjct: 314 IATGQTYEKDSIQKWFDKGHKTCPKTRQELEHLSLAPNFALKNLIMQWCEKNNFKLPEK 372 Score = 47.0 bits (110), Expect(2) = 2e-27 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = -1 Query: 354 LVKAKGKCAI---QQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 L++ KG I Q +++LL KFK++ G++ +L P + + KS+SL++PHEF Sbjct: 244 LIQDKGGLCIETKQHIIELLNKFKKLQGLEATDILYQPVINKAFTKSKSLILPHEF 299 >ref|NP_199049.2| U-box domain-containing protein 15 [Arabidopsis thaliana] gi|172044652|sp|Q681N2.2|PUB15_ARATH RecName: Full=U-box domain-containing protein 15; AltName: Full=Plant U-box protein 15 gi|332007415|gb|AED94798.1| U-box domain-containing protein 15 [Arabidopsis thaliana] Length = 660 Score = 102 bits (254), Expect(2) = 2e-27 Identities = 41/59 (69%), Positives = 57/59 (96%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 IATGQTYE+ESIQ+W ++GH+TCPKT Q+L++L++APNFAL+NLI+QWCEKNN+++P+K Sbjct: 309 IATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFALKNLIMQWCEKNNFKIPEK 367 Score = 45.8 bits (107), Expect(2) = 2e-27 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = -1 Query: 354 LVKAKGKCAI---QQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 L++ KG I Q +++LL KFK++ G++ +L P + + + KS SL++PHEF Sbjct: 239 LIQDKGGLNIETKQHIIELLNKFKKLQGLEATDILYQPVINKAITKSTSLILPHEF 294 >dbj|BAD43348.1| arm repeat containing protein [Arabidopsis thaliana] Length = 660 Score = 102 bits (254), Expect(2) = 2e-27 Identities = 41/59 (69%), Positives = 57/59 (96%) Frame = -3 Query: 178 IATGQTYERESIQRWLNSGHRTCPKTGQKLNYLTVAPNFALRNLIIQWCEKNNYELPKK 2 IATGQTYE+ESIQ+W ++GH+TCPKT Q+L++L++APNFAL+NLI+QWCEKNN+++P+K Sbjct: 309 IATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFALKNLIMQWCEKNNFKIPEK 367 Score = 45.8 bits (107), Expect(2) = 2e-27 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = -1 Query: 354 LVKAKGKCAI---QQVVDLLEKFKQIAGIDENSVLDGPALVRCLEKSRSLLIPHEF 196 L++ KG I Q +++LL KFK++ G++ +L P + + + KS SL++PHEF Sbjct: 239 LIQDKGGLNIETKQHIIELLNKFKKLQGLEATDILYQPVINKAITKSTSLILPHEF 294