BLASTX nr result
ID: Rehmannia26_contig00023693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00023693 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] 65 1e-08 ref|XP_004244714.1| PREDICTED: putative DNA-binding protein ESCA... 64 3e-08 ref|XP_006358367.1| PREDICTED: putative DNA-binding protein ESCA... 61 1e-07 ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCA... 61 2e-07 ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCA... 61 2e-07 gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis] 59 5e-07 gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao] 56 6e-06 >gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] Length = 293 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -1 Query: 286 GGDPS-LFQGMPPNLFNSIQMPNDAFWATGRPPF 188 GGDPS LF GMPPNL NSIQ+PN+A+WATGRPPF Sbjct: 260 GGDPSALFHGMPPNLLNSIQLPNEAYWATGRPPF 293 >ref|XP_004244714.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum lycopersicum] Length = 303 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 283 GDPSLFQGMPPNLFNSIQMPNDAFWATGRPPF 188 GDPSLF GMPPNL N++Q+P++A+WATGRPPF Sbjct: 272 GDPSLFHGMPPNLLNNVQLPSEAYWATGRPPF 303 >ref|XP_006358367.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum tuberosum] Length = 311 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 280 DPSLFQGMPPNLFNSIQMPNDAFWATGRPPF 188 DPSLF GMPPNL N++Q+P++A+WATGRPPF Sbjct: 281 DPSLFHGMPPNLLNNVQLPSEAYWATGRPPF 311 >ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum tuberosum] Length = 293 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 280 DPSLFQGMPPNLFNSIQMPNDAFWATGRPPF 188 DPSLF GMPPNL NSIQ+P++ +WATGRPPF Sbjct: 263 DPSLFHGMPPNLLNSIQLPSEPYWATGRPPF 293 >ref|XP_004245690.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum lycopersicum] Length = 292 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 280 DPSLFQGMPPNLFNSIQMPNDAFWATGRPPF 188 DPSLF GMPPNL NSIQ+P++ +WATGRPPF Sbjct: 262 DPSLFHGMPPNLLNSIQLPSEPYWATGRPPF 292 >gb|EXC17834.1| hypothetical protein L484_023188 [Morus notabilis] Length = 302 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 286 GGDPSLFQGMPPNLFNSIQMPNDAFWATGRPPF 188 GG P+LF G+PPNL NSIQMP +A+WA+GRPP+ Sbjct: 270 GGAPTLFHGLPPNLLNSIQMPAEAYWASGRPPY 302 >gb|EOY24520.1| AT-hook DNA-binding family protein [Theobroma cacao] Length = 302 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 271 LFQGMPPNLFNSIQMPNDAFWATGRPPF 188 LF G+PPNL NSIQ+P +AFWATGRPPF Sbjct: 275 LFHGLPPNLLNSIQLPTEAFWATGRPPF 302