BLASTX nr result
ID: Rehmannia26_contig00023641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00023641 (395 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251278.1| PREDICTED: nitrate excretion transporter 1-l... 57 2e-08 ref|XP_006366402.1| PREDICTED: nitrate excretion transporter 1-l... 54 2e-07 gb|EOY33138.1| Nitrate excretion transporter1, putative [Theobro... 49 3e-07 ref|XP_006366414.1| PREDICTED: probable nitrate excretion transp... 55 4e-07 gb|AAT39313.2| POT family protein [Solanum demissum] 55 4e-07 ref|XP_004241261.1| PREDICTED: nitrate excretion transporter 1-l... 52 6e-07 gb|AAT39312.2| Major Facilitator Superfamily protein [Solanum de... 54 7e-07 gb|AAT39311.2| POT family protein [Solanum demissum] 54 7e-07 ref|XP_004251445.1| PREDICTED: nitrate excretion transporter 1-l... 54 1e-06 ref|XP_006365767.1| PREDICTED: nitrate excretion transporter 1-l... 51 1e-06 ref|XP_006365763.1| PREDICTED: probable nitrate excretion transp... 57 2e-06 ref|XP_004164150.1| PREDICTED: nitrate excretion transporter 1-l... 43 1e-05 gb|ADN34243.1| peptide transporter [Cucumis melo subsp. melo] 43 1e-05 >ref|XP_004251278.1| PREDICTED: nitrate excretion transporter 1-like [Solanum lycopersicum] Length = 559 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG ++ADS+LGCFSVIWFSSLIS L Sbjct: 72 NGCTTLFPIVGGILADSYLGCFSVIWFSSLISAL 105 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 262 TMACLTLASGGWVAN 306 TMA L+LASGGW +N Sbjct: 34 TMAGLSLASGGWTSN 48 >ref|XP_006366402.1| PREDICTED: nitrate excretion transporter 1-like [Solanum tuberosum] Length = 565 Score = 53.5 bits (127), Expect(2) = 2e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG ++ADS+LG FSVIWFSSLIS L Sbjct: 72 NGCTTLFPIVGGILADSYLGSFSVIWFSSLISAL 105 Score = 26.9 bits (58), Expect(2) = 2e-07 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 262 TMACLTLASGGWVAN 306 TMA L+LASGGW +N Sbjct: 34 TMAGLSLASGGWTSN 48 >gb|EOY33138.1| Nitrate excretion transporter1, putative [Theobroma cacao] Length = 559 Score = 48.9 bits (115), Expect(2) = 3e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 281 SLLEDGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 S + +G ++FPIVGA+IADSFLGCFSV+ S ISLL Sbjct: 64 SNIVNGGSSLFPIVGAIIADSFLGCFSVVSIFSCISLL 101 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 259 GTMACLTLASGGWVAN 306 GT+A LTLA GGWVAN Sbjct: 29 GTLAGLTLAGGGWVAN 44 >ref|XP_006366414.1| PREDICTED: probable nitrate excretion transporter 2-like [Solanum tuberosum] Length = 526 Score = 55.5 bits (132), Expect(2) = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG +IADS+LGCFSVIW SSLIS L Sbjct: 38 NGLTTIFPIVGGIIADSYLGCFSVIWISSLISAL 71 Score = 23.9 bits (50), Expect(2) = 4e-07 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 265 MACLTLASGGWVAN 306 MA L+LA+GGW +N Sbjct: 1 MAGLSLAAGGWTSN 14 >gb|AAT39313.2| POT family protein [Solanum demissum] Length = 513 Score = 55.5 bits (132), Expect(2) = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG +IADS+LGCFSVIW SSLIS L Sbjct: 38 NGLTTIFPIVGGIIADSYLGCFSVIWISSLISAL 71 Score = 23.9 bits (50), Expect(2) = 4e-07 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 265 MACLTLASGGWVAN 306 MA L+LA+GGW +N Sbjct: 1 MAGLSLAAGGWTSN 14 >ref|XP_004241261.1| PREDICTED: nitrate excretion transporter 1-like [Solanum lycopersicum] Length = 554 Score = 52.0 bits (123), Expect(2) = 6e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +2 Query: 287 LEDGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 L +G ++ P+V A+IADSFLGCFS+IW SS+ISLL Sbjct: 67 LVNGAGSLIPVVAAIIADSFLGCFSIIWISSIISLL 102 Score = 26.9 bits (58), Expect(2) = 6e-07 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 262 TMACLTLASGGWVAN 306 T CLTLA GGW +N Sbjct: 31 TTTCLTLAFGGWTSN 45 >gb|AAT39312.2| Major Facilitator Superfamily protein [Solanum demissum] Length = 531 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG ++ADS+LG FSVIWFSSLIS L Sbjct: 38 NGCTTLFPIVGGILADSYLGSFSVIWFSSLISAL 71 Score = 25.0 bits (53), Expect(2) = 7e-07 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 265 MACLTLASGGWVAN 306 MA L+LASGGW +N Sbjct: 1 MAGLSLASGGWTSN 14 >gb|AAT39311.2| POT family protein [Solanum demissum] Length = 531 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG ++ADS+LG FSVIWFSSLIS L Sbjct: 38 NGCTTLFPIVGGILADSYLGSFSVIWFSSLISAL 71 Score = 25.0 bits (53), Expect(2) = 7e-07 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 265 MACLTLASGGWVAN 306 MA L+LASGGW +N Sbjct: 1 MAGLSLASGGWTSN 14 >ref|XP_004251445.1| PREDICTED: nitrate excretion transporter 1-like [Solanum lycopersicum] Length = 525 Score = 54.3 bits (129), Expect(2) = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G T+FPIVG +IADS+LGCF+VIW SSLIS L Sbjct: 38 NGLTTIFPIVGGIIADSYLGCFTVIWISSLISAL 71 Score = 23.9 bits (50), Expect(2) = 1e-06 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 265 MACLTLASGGWVAN 306 MA L+LA+GGW +N Sbjct: 1 MAGLSLAAGGWTSN 14 >ref|XP_006365767.1| PREDICTED: nitrate excretion transporter 1-like [Solanum tuberosum] Length = 554 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 281 SLLEDGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 S L +G ++ PI+ A+IADSFLGCFS+IW SS ISLL Sbjct: 65 SNLVNGAGSLIPILAAIIADSFLGCFSIIWLSSFISLL 102 Score = 26.9 bits (58), Expect(2) = 1e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 262 TMACLTLASGGWVAN 306 T CLTLA GGW +N Sbjct: 31 TSTCLTLAFGGWTSN 45 >ref|XP_006365763.1| PREDICTED: probable nitrate excretion transporter 3-like [Solanum tuberosum] Length = 530 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 287 LEDGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 + +G T+FPI+GAV+ADSFLGCFSVIW SS ISLL Sbjct: 36 MANGCSTIFPILGAVVADSFLGCFSVIWISSFISLL 71 >ref|XP_004164150.1| PREDICTED: nitrate excretion transporter 1-like [Cucumis sativus] Length = 570 Score = 42.7 bits (99), Expect(2) = 1e-05 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 281 SLLEDGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 S + G L +FP+VGAV+ADSF G F VI S+ ISLL Sbjct: 63 SNIVSGCLCVFPVVGAVLADSFFGSFFVILISTSISLL 100 Score = 32.0 bits (71), Expect(2) = 1e-05 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +1 Query: 259 GTMACLTLASGGWVAN 306 GT AC+TLA+GGW++N Sbjct: 28 GTFACMTLATGGWLSN 43 >gb|ADN34243.1| peptide transporter [Cucumis melo subsp. melo] Length = 569 Score = 43.1 bits (100), Expect(2) = 1e-05 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +2 Query: 293 DGWLTMFPIVGAVIADSFLGCFSVIWFSSLISLL 394 +G L++FP+VGAV+ADSF G F VI S+ ISLL Sbjct: 66 NGCLSVFPVVGAVLADSFFGSFFVIVISTSISLL 99 Score = 31.6 bits (70), Expect(2) = 1e-05 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +1 Query: 259 GTMACLTLASGGWVAN 306 G+ AC+TLA+GGW+AN Sbjct: 27 GSFACMTLATGGWLAN 42