BLASTX nr result
ID: Rehmannia26_contig00023209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00023209 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006452512.1| hypothetical protein CICLE_v10009052mg [Citr... 112 5e-23 ref|XP_003617691.1| MAP kinase-like protein [Medicago truncatula... 112 7e-23 ref|XP_002529046.1| ATP binding protein, putative [Ricinus commu... 111 9e-23 ref|XP_003519617.2| PREDICTED: probable serine/threonine-protein... 111 1e-22 ref|XP_003544713.1| PREDICTED: probable serine/threonine-protein... 111 1e-22 gb|EXB67431.1| putative serine/threonine-protein kinase WNK11 [M... 110 2e-22 gb|ESW14371.1| hypothetical protein PHAVU_008G275100g [Phaseolus... 110 3e-22 ref|XP_006469522.1| PREDICTED: probable serine/threonine-protein... 109 3e-22 ref|XP_006469521.1| PREDICTED: probable serine/threonine-protein... 109 3e-22 gb|ESW18584.1| hypothetical protein PHAVU_006G053100g [Phaseolus... 109 3e-22 ref|XP_006447742.1| hypothetical protein CICLE_v10015796mg [Citr... 109 3e-22 ref|XP_003600253.1| MAP kinase-like protein [Medicago truncatula... 109 3e-22 ref|XP_003553016.2| PREDICTED: probable serine/threonine-protein... 108 1e-21 ref|XP_004491472.1| PREDICTED: probable serine/threonine-protein... 108 1e-21 ref|XP_004491471.1| PREDICTED: probable serine/threonine-protein... 108 1e-21 gb|EMJ12907.1| hypothetical protein PRUPE_ppa009318mg [Prunus pe... 108 1e-21 ref|XP_006346163.1| PREDICTED: probable serine/threonine-protein... 107 1e-21 gb|ESW14499.1| hypothetical protein PHAVU_008G286300g [Phaseolus... 107 1e-21 ref|XP_003519670.1| PREDICTED: probable serine/threonine-protein... 107 1e-21 ref|XP_006591734.1| PREDICTED: probable serine/threonine-protein... 107 2e-21 >ref|XP_006452512.1| hypothetical protein CICLE_v10009052mg [Citrus clementina] gi|568842018|ref|XP_006474950.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Citrus sinensis] gi|557555738|gb|ESR65752.1| hypothetical protein CICLE_v10009052mg [Citrus clementina] Length = 296 Score = 112 bits (280), Expect = 5e-23 Identities = 50/60 (83%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SG RP A+NK+KDPEV+EFIE+CLAQPR+RPSAA+LLKDPFF Sbjct: 226 EIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEFIERCLAQPRARPSAAELLKDPFF 285 >ref|XP_003617691.1| MAP kinase-like protein [Medicago truncatula] gi|355519026|gb|AET00650.1| MAP kinase-like protein [Medicago truncatula] Length = 305 Score = 112 bits (279), Expect = 7e-23 Identities = 51/60 (85%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SG+RP AMNKVKD EV+EFIE+CLAQPR+RPSAA+LLKDPFF Sbjct: 226 EIPYSECDNVAKIYKKVSSGIRPAAMNKVKDSEVKEFIERCLAQPRARPSAAELLKDPFF 285 >ref|XP_002529046.1| ATP binding protein, putative [Ricinus communis] gi|223531526|gb|EEF33357.1| ATP binding protein, putative [Ricinus communis] Length = 298 Score = 111 bits (278), Expect = 9e-23 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVA+IYKKV+SG+RP A+NKVKDPEV+ FIEKCLAQPR RPSAADLLKDPFF Sbjct: 225 EIPYSECDNVARIYKKVSSGIRPLALNKVKDPEVKAFIEKCLAQPRVRPSAADLLKDPFF 284 >ref|XP_003519617.2| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 300 Score = 111 bits (277), Expect = 1e-22 Identities = 50/60 (83%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SG+RP A+NKVKDPEV+ FIEKCLAQPR+RPSAA+LL+DPFF Sbjct: 223 EIPYSECDNVAKIYKKVSSGVRPAALNKVKDPEVKAFIEKCLAQPRARPSAAELLRDPFF 282 >ref|XP_003544713.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 299 Score = 111 bits (277), Expect = 1e-22 Identities = 50/60 (83%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SG+RP A+NKVKDPEV+ FIEKCLAQPR+RPSAA+LL+DPFF Sbjct: 223 EIPYSECDNVAKIYKKVSSGVRPAALNKVKDPEVKAFIEKCLAQPRARPSAAELLRDPFF 282 >gb|EXB67431.1| putative serine/threonine-protein kinase WNK11 [Morus notabilis] Length = 301 Score = 110 bits (275), Expect = 2e-22 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKVTSG+RP A++KV+DPEVR F+EKCLAQPR+RPSA +LLKDPFF Sbjct: 224 EIPYSECDNVAKIYKKVTSGVRPHALSKVRDPEVRAFVEKCLAQPRARPSATELLKDPFF 283 >gb|ESW14371.1| hypothetical protein PHAVU_008G275100g [Phaseolus vulgaris] Length = 306 Score = 110 bits (274), Expect = 3e-22 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV SG+RP A+NKVKDPEV+ FIEKCLAQPR+RPSAADLLKD FF Sbjct: 239 EIPYSECDNVAKIYKKVCSGVRPAALNKVKDPEVKAFIEKCLAQPRARPSAADLLKDSFF 298 >ref|XP_006469522.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X2 [Citrus sinensis] Length = 289 Score = 109 bits (273), Expect = 3e-22 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKVT G++PQA+NKVKDPEV+ FIEKC+AQPR+RPSA++LLKDPFF Sbjct: 218 EIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFF 277 >ref|XP_006469521.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X1 [Citrus sinensis] Length = 296 Score = 109 bits (273), Expect = 3e-22 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKVT G++PQA+NKVKDPEV+ FIEKC+AQPR+RPSA++LLKDPFF Sbjct: 225 EIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFF 284 >gb|ESW18584.1| hypothetical protein PHAVU_006G053100g [Phaseolus vulgaris] Length = 299 Score = 109 bits (273), Expect = 3e-22 Identities = 48/60 (80%), Positives = 59/60 (98%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SG+RP+A++K++DPEV+ FIEKCLAQPR+RPSAA+LLKDPFF Sbjct: 226 EIPYSECDNVAKIYKKVSSGVRPEALSKIQDPEVKAFIEKCLAQPRARPSAAELLKDPFF 285 >ref|XP_006447742.1| hypothetical protein CICLE_v10015796mg [Citrus clementina] gi|557550353|gb|ESR60982.1| hypothetical protein CICLE_v10015796mg [Citrus clementina] Length = 348 Score = 109 bits (273), Expect = 3e-22 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKVT G++PQA+NKVKDPEV+ FIEKC+AQPR+RPSA++LLKDPFF Sbjct: 277 EIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFF 336 >ref|XP_003600253.1| MAP kinase-like protein [Medicago truncatula] gi|355489301|gb|AES70504.1| MAP kinase-like protein [Medicago truncatula] Length = 279 Score = 109 bits (273), Expect = 3e-22 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKVTSG+RPQ++NK+KD EV+ FIEKCLAQPR+RPSA +LLKDPFF Sbjct: 207 EIPYSECDNVAKIYKKVTSGVRPQSLNKIKDAEVKTFIEKCLAQPRARPSAEELLKDPFF 266 >ref|XP_003553016.2| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 299 Score = 108 bits (269), Expect = 1e-21 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKV+SG+RPQA+NK+KD EV+ FIE+CLAQPR+RPSAA+LLKDPFF Sbjct: 226 EIPYSECDSVAKIYKKVSSGVRPQALNKIKDAEVKAFIERCLAQPRARPSAAELLKDPFF 285 >ref|XP_004491472.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X2 [Cicer arietinum] Length = 303 Score = 108 bits (269), Expect = 1e-21 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SGLRP A+NKVKD EV+ FIEKCLAQPR+RPSA +LLKDPFF Sbjct: 225 EIPYSECDNVAKIYKKVSSGLRPAALNKVKDSEVKAFIEKCLAQPRARPSADELLKDPFF 284 >ref|XP_004491471.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X1 [Cicer arietinum] Length = 304 Score = 108 bits (269), Expect = 1e-21 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNVAKIYKKV+SGLRP A+NKVKD EV+ FIEKCLAQPR+RPSA +LLKDPFF Sbjct: 226 EIPYSECDNVAKIYKKVSSGLRPAALNKVKDSEVKAFIEKCLAQPRARPSADELLKDPFF 285 >gb|EMJ12907.1| hypothetical protein PRUPE_ppa009318mg [Prunus persica] Length = 297 Score = 108 bits (269), Expect = 1e-21 Identities = 47/60 (78%), Positives = 56/60 (93%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNV KIYKKVTSG+RPQ++NKV+DPEV+ F+EKCLAQPR+RPSA +LL DPFF Sbjct: 224 EIPYSECDNVVKIYKKVTSGVRPQSLNKVEDPEVKAFVEKCLAQPRARPSATELLNDPFF 283 >ref|XP_006346163.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Solanum tuberosum] Length = 306 Score = 107 bits (268), Expect = 1e-21 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 ELPYSECDNV KIYKKV SG+RP+AM+KVKDPEV++FIEKCLAQPR RPSA++LL+DPFF Sbjct: 225 ELPYSECDNVVKIYKKVISGVRPKAMDKVKDPEVKKFIEKCLAQPRVRPSASELLQDPFF 284 >gb|ESW14499.1| hypothetical protein PHAVU_008G286300g [Phaseolus vulgaris] Length = 297 Score = 107 bits (268), Expect = 1e-21 Identities = 47/60 (78%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKVT G++PQA++KV +PEV+EFIEKC+AQPR+RPSA DLLKDPFF Sbjct: 225 EIPYSECDSVAKIYKKVTKGIKPQALSKVTEPEVKEFIEKCIAQPRARPSATDLLKDPFF 284 >ref|XP_003519670.1| PREDICTED: probable serine/threonine-protein kinase WNK11 isoform X1 [Glycine max] gi|571442489|ref|XP_006575745.1| PREDICTED: probable serine/threonine-protein kinase WNK11 isoform X2 [Glycine max] Length = 297 Score = 107 bits (268), Expect = 1e-21 Identities = 47/60 (78%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECD+VAKIYKKVT G++P+A++KV DPEV+EFIEKC+AQPR+RPSA DLLKDPFF Sbjct: 225 EIPYSECDSVAKIYKKVTMGIKPEALSKVTDPEVKEFIEKCIAQPRARPSATDLLKDPFF 284 >ref|XP_006591734.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 107 Score = 107 bits (267), Expect = 2e-21 Identities = 48/60 (80%), Positives = 57/60 (95%) Frame = +1 Query: 1 ELPYSECDNVAKIYKKVTSGLRPQAMNKVKDPEVREFIEKCLAQPRSRPSAADLLKDPFF 180 E+PYSECDNV KIYKKV+SG+RP A+NKVKDP+V+ FIEKCLAQPR+RPSAA+LL+DPFF Sbjct: 30 EIPYSECDNVDKIYKKVSSGVRPTALNKVKDPKVKAFIEKCLAQPRARPSAAELLRDPFF 89