BLASTX nr result
ID: Rehmannia26_contig00022949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022949 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65243.1| hypothetical protein VITISV_010925 [Vitis vinifera] 106 3e-21 gb|EXC25116.1| hypothetical protein L484_003040 [Morus notabilis] 101 1e-19 ref|XP_002521080.1| conserved hypothetical protein [Ricinus comm... 100 3e-19 ref|XP_004144384.1| PREDICTED: protein XRI1-like [Cucumis sativu... 99 6e-19 gb|EOX93911.1| X-ray induced transcript 1, putative [Theobroma c... 99 8e-19 gb|EMJ03086.1| hypothetical protein PRUPE_ppa009835mg [Prunus pe... 98 1e-18 ref|XP_004290201.1| PREDICTED: protein XRI1-like [Fragaria vesca... 96 4e-18 ref|XP_006486639.1| PREDICTED: protein XRI1-like isoform X4 [Cit... 96 5e-18 ref|XP_006486637.1| PREDICTED: protein XRI1-like isoform X2 [Cit... 96 5e-18 ref|XP_006486636.1| PREDICTED: protein XRI1-like isoform X1 [Cit... 96 5e-18 ref|XP_006476585.1| PREDICTED: protein XRI1-like [Citrus sinensis] 96 5e-18 ref|XP_006439567.1| hypothetical protein CICLE_v10021149mg [Citr... 96 5e-18 ref|XP_006422471.1| hypothetical protein CICLE_v10028898mg [Citr... 96 5e-18 ref|XP_004247587.1| PREDICTED: protein XRI1-like [Solanum lycope... 94 1e-17 ref|XP_006360750.1| PREDICTED: protein XRI1-like [Solanum tubero... 94 2e-17 ref|XP_002303048.2| hypothetical protein POPTR_0002s24550g [Popu... 94 2e-17 ref|XP_006386874.1| hypothetical protein POPTR_0002s24550g [Popu... 94 2e-17 ref|XP_004516312.1| PREDICTED: protein XRI1-like [Cicer arietinum] 94 2e-17 gb|ESW06107.1| hypothetical protein PHAVU_010G020000g [Phaseolus... 92 5e-17 ref|XP_004513524.1| PREDICTED: protein XRI1-like [Cicer arietinum] 92 7e-17 >emb|CAN65243.1| hypothetical protein VITISV_010925 [Vitis vinifera] Length = 320 Score = 106 bits (265), Expect = 3e-21 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQRI PP KS+ + EDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 259 DVTLKDINQRIRTPPPSKSRQSNEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 318 Query: 177 KG 182 KG Sbjct: 319 KG 320 >gb|EXC25116.1| hypothetical protein L484_003040 [Morus notabilis] Length = 303 Score = 101 bits (251), Expect = 1e-19 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPPK--SKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQ+I PP SK EDPSV++PTSAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 242 DVTLKDINQKIRTPPPPISKQKNEDPSVAFPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 301 Query: 177 KG 182 KG Sbjct: 302 KG 303 >ref|XP_002521080.1| conserved hypothetical protein [Ricinus communis] gi|223539649|gb|EEF41231.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 99.8 bits (247), Expect = 3e-19 Identities = 52/62 (83%), Positives = 55/62 (88%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKSK--PNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQ+I PP SK NEEDP+ +YPTSAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 233 DVTLKDINQKIRTPPPSKLKQNEEDPA-AYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 291 Query: 177 KG 182 KG Sbjct: 292 KG 293 >ref|XP_004144384.1| PREDICTED: protein XRI1-like [Cucumis sativus] gi|449529551|ref|XP_004171763.1| PREDICTED: protein XRI1-like [Cucumis sativus] Length = 304 Score = 99.0 bits (245), Expect = 6e-19 Identities = 51/62 (82%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKSKPNE--EDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQRI PP SK EDPS SYPTSAFSGKPVVGKTKI TEGGKGSITIMRT Sbjct: 243 DVTLKDINQRIRTPPPSKLKHQPEDPSESYPTSAFSGKPVVGKTKIHTEGGKGSITIMRT 302 Query: 177 KG 182 +G Sbjct: 303 RG 304 >gb|EOX93911.1| X-ray induced transcript 1, putative [Theobroma cacao] Length = 301 Score = 98.6 bits (244), Expect = 8e-19 Identities = 50/62 (80%), Positives = 54/62 (87%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQRI PP KSK + ED + ++PTSAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 240 DVTLKDINQRIRTPPPSKSKQSNEDLAAAFPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 299 Query: 177 KG 182 KG Sbjct: 300 KG 301 >gb|EMJ03086.1| hypothetical protein PRUPE_ppa009835mg [Prunus persica] Length = 275 Score = 98.2 bits (243), Expect = 1e-18 Identities = 52/62 (83%), Positives = 54/62 (87%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLKDINQRI PP KSK EDP+ +YPTSAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 215 DVTLKDINQRIRTPPPSKSKQKYEDPA-AYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 273 Query: 177 KG 182 KG Sbjct: 274 KG 275 >ref|XP_004290201.1| PREDICTED: protein XRI1-like [Fragaria vesca subsp. vesca] Length = 299 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = +3 Query: 6 VTLKDINQRIHNPPKSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 182 VTLKDINQRI PP SK +++P YPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG Sbjct: 242 VTLKDINQRIRTPPPSKAKQKEPE-QYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 299 >ref|XP_006486639.1| PREDICTED: protein XRI1-like isoform X4 [Citrus sinensis] Length = 275 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/61 (80%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKS-KPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 D+TLKDINQRIH+P + + N EDPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRTK Sbjct: 216 DITLKDINQRIHSPASTLRQNTEDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTK 274 Query: 180 G 182 G Sbjct: 275 G 275 >ref|XP_006486637.1| PREDICTED: protein XRI1-like isoform X2 [Citrus sinensis] gi|568866596|ref|XP_006486638.1| PREDICTED: protein XRI1-like isoform X3 [Citrus sinensis] Length = 276 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/61 (80%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKS-KPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 D+TLKDINQRIH+P + + N EDPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRTK Sbjct: 217 DITLKDINQRIHSPASTLRQNTEDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTK 275 Query: 180 G 182 G Sbjct: 276 G 276 >ref|XP_006486636.1| PREDICTED: protein XRI1-like isoform X1 [Citrus sinensis] Length = 277 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/61 (80%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKS-KPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 D+TLKDINQRIH+P + + N EDPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRTK Sbjct: 218 DITLKDINQRIHSPASTLRQNTEDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTK 276 Query: 180 G 182 G Sbjct: 277 G 277 >ref|XP_006476585.1| PREDICTED: protein XRI1-like [Citrus sinensis] Length = 325 Score = 95.9 bits (237), Expect = 5e-18 Identities = 50/61 (81%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNP-PKSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 DVTL DINQRIH+P K+K N +DPS +YPTSAFSGKPVVGKTKI TEGGKGSITIMRTK Sbjct: 266 DVTLNDINQRIHSPGSKTKQNIDDPS-AYPTSAFSGKPVVGKTKIHTEGGKGSITIMRTK 324 Query: 180 G 182 G Sbjct: 325 G 325 >ref|XP_006439567.1| hypothetical protein CICLE_v10021149mg [Citrus clementina] gi|557541829|gb|ESR52807.1| hypothetical protein CICLE_v10021149mg [Citrus clementina] Length = 325 Score = 95.9 bits (237), Expect = 5e-18 Identities = 50/61 (81%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNP-PKSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 DVTL DINQRIH+P K+K N +DPS +YPTSAFSGKPVVGKTKI TEGGKGSITIMRTK Sbjct: 266 DVTLNDINQRIHSPGSKTKQNIDDPS-AYPTSAFSGKPVVGKTKIHTEGGKGSITIMRTK 324 Query: 180 G 182 G Sbjct: 325 G 325 >ref|XP_006422471.1| hypothetical protein CICLE_v10028898mg [Citrus clementina] gi|557524405|gb|ESR35711.1| hypothetical protein CICLE_v10028898mg [Citrus clementina] Length = 308 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/61 (80%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKS-KPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 D+TLKDINQRIH+P + + N EDPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRTK Sbjct: 249 DITLKDINQRIHSPASTLRQNTEDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRTK 307 Query: 180 G 182 G Sbjct: 308 G 308 >ref|XP_004247587.1| PREDICTED: protein XRI1-like [Solanum lycopersicum] Length = 293 Score = 94.4 bits (233), Expect = 1e-17 Identities = 49/61 (80%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKSKP-NEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 DVTLKDINQRI P P N EDPSV+YP SAFSGKPVVGKT I TEGGKGSITIMRTK Sbjct: 233 DVTLKDINQRIRTPKLKTPQNVEDPSVAYPKSAFSGKPVVGKTTIPTEGGKGSITIMRTK 292 Query: 180 G 182 G Sbjct: 293 G 293 >ref|XP_006360750.1| PREDICTED: protein XRI1-like [Solanum tuberosum] Length = 293 Score = 94.0 bits (232), Expect = 2e-17 Identities = 49/61 (80%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = +3 Query: 3 DVTLKDINQRIHNPPKSKP-NEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTK 179 DVTLKDINQRI P P N EDPSV+YP SAFSGKPVVGKT I TEGGKGSITIMRTK Sbjct: 233 DVTLKDINQRIRTPKLKTPQNIEDPSVAYPKSAFSGKPVVGKTTIPTEGGKGSITIMRTK 292 Query: 180 G 182 G Sbjct: 293 G 293 >ref|XP_002303048.2| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] gi|550345746|gb|EEE82321.2| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] Length = 309 Score = 94.0 bits (232), Expect = 2e-17 Identities = 50/62 (80%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTL +INQRI PP KSK +EDP V YP SAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 249 DVTLNEINQRIRTPPPSKSKQKDEDPVV-YPMSAFSGKPVVGKTKIRTEGGKGSITIMRT 307 Query: 177 KG 182 KG Sbjct: 308 KG 309 >ref|XP_006386874.1| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] gi|550345745|gb|ERP64671.1| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] Length = 302 Score = 94.0 bits (232), Expect = 2e-17 Identities = 50/62 (80%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTL +INQRI PP KSK +EDP V YP SAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 242 DVTLNEINQRIRTPPPSKSKQKDEDPVV-YPMSAFSGKPVVGKTKIRTEGGKGSITIMRT 300 Query: 177 KG 182 KG Sbjct: 301 KG 302 >ref|XP_004516312.1| PREDICTED: protein XRI1-like [Cicer arietinum] Length = 295 Score = 94.0 bits (232), Expect = 2e-17 Identities = 50/62 (80%), Positives = 53/62 (85%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLK+INQRI PP KSK +DPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 235 DVTLKEINQRIRTPPPSKSKQISDDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRT 293 Query: 177 KG 182 KG Sbjct: 294 KG 295 >gb|ESW06107.1| hypothetical protein PHAVU_010G020000g [Phaseolus vulgaris] Length = 311 Score = 92.4 bits (228), Expect = 5e-17 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLK+INQRI P KSK + +DPS +YP SAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 251 DVTLKEINQRIRTPAPSKSKQSSDDPS-AYPKSAFSGKPVVGKTKIRTEGGKGSITIMRT 309 Query: 177 KG 182 KG Sbjct: 310 KG 311 >ref|XP_004513524.1| PREDICTED: protein XRI1-like [Cicer arietinum] Length = 300 Score = 92.0 bits (227), Expect = 7e-17 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 2/62 (3%) Frame = +3 Query: 3 DVTLKDINQRIHNPP--KSKPNEEDPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRT 176 DVTLK+IN+RI +PP KSK +EDP V YP SAFSGKPVVGKTKIRTEGGKGSITIMRT Sbjct: 240 DVTLKEINKRIQSPPPSKSKQVKEDPIV-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRT 298 Query: 177 KG 182 +G Sbjct: 299 RG 300