BLASTX nr result
ID: Rehmannia26_contig00022915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022915 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB53969.1| hypothetical protein L484_022937 [Morus notabilis] 55 7e-06 >gb|EXB53969.1| hypothetical protein L484_022937 [Morus notabilis] Length = 98 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 5/86 (5%) Frame = +2 Query: 101 LIFLAFLLIANMSNCCTAIRAGRTTTTMMMKEDDASLMTLKYFQEKNEKYFPDGLYFTK- 277 +I L+I+ ++ C+A R G+ + M + E + T ++ NE + G F Sbjct: 17 IIIATILIISLLTGSCSAARLGKISLMMKITETTSQTST----EKNNELHLQTGFQFRGQ 72 Query: 278 ----LPKGVPIPPSAPSNRHNSSPHN 343 PKG P+PPS PS RHNSSP N Sbjct: 73 TFNFFPKGKPVPPSGPSKRHNSSPKN 98