BLASTX nr result
ID: Rehmannia26_contig00022870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022870 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152822.1| PREDICTED: probable sodium-coupled neutral a... 60 2e-07 gb|EXB77624.1| hypothetical protein L484_018140 [Morus notabilis] 60 3e-07 ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral a... 60 3e-07 ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citr... 60 3e-07 ref|XP_002514570.1| amino acid transporter, putative [Ricinus co... 59 5e-07 ref|XP_006338315.1| PREDICTED: probable sodium-coupled neutral a... 59 9e-07 ref|XP_004232123.1| PREDICTED: sodium-coupled neutral amino acid... 59 9e-07 emb|CBI16906.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002282329.1| PREDICTED: sodium-coupled neutral amino acid... 59 9e-07 emb|CAN67024.1| hypothetical protein VITISV_036511 [Vitis vinifera] 59 9e-07 gb|EOY03853.1| Transmembrane amino acid transporter family prote... 58 1e-06 ref|XP_002534057.1| amino acid transporter, putative [Ricinus co... 57 2e-06 ref|XP_004297186.1| PREDICTED: probable sodium-coupled neutral a... 57 3e-06 ref|XP_006365650.1| PREDICTED: sodium-coupled neutral amino acid... 56 4e-06 ref|XP_004233397.1| PREDICTED: probable sodium-coupled neutral a... 56 4e-06 gb|ADD54601.1| putative amino acid transporter [Linum usitatissi... 55 1e-05 ref|XP_002331285.1| amino acid transporter [Populus trichocarpa]... 55 1e-05 >ref|XP_004152822.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Cucumis sativus] gi|449477713|ref|XP_004155101.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Cucumis sativus] Length = 462 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/43 (58%), Positives = 37/43 (86%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 DSH + ++K+K+L VFMV LAVF++++AIYSDAYA+F R++ P Sbjct: 418 DSHNIATKKDKVLGVFMVVLAVFSNIIAIYSDAYALFKRDSSP 460 >gb|EXB77624.1| hypothetical protein L484_018140 [Morus notabilis] Length = 463 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D H + ++K+K+L VFM+ LAVF++LVAIYSDAY++F +NA P Sbjct: 419 DRHNIATKKDKVLCVFMIVLAVFSNLVAIYSDAYSLFKKNASP 461 >ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Citrus sinensis] Length = 462 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPPS 183 D H + ++K+KIL +FM+ LAVF+++VAIYSDA+A+F +NA PS Sbjct: 418 DRHNIATKKDKILCIFMIVLAVFSNVVAIYSDAFALFKKNASPS 461 >ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] gi|557533048|gb|ESR44231.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] Length = 462 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPPS 183 D H + ++K+KIL +FM+ LAVF+++VAIYSDA+A+F +NA PS Sbjct: 418 DRHSIATKKDKILCIFMIVLAVFSNVVAIYSDAFALFKKNASPS 461 >ref|XP_002514570.1| amino acid transporter, putative [Ricinus communis] gi|223546174|gb|EEF47676.1| amino acid transporter, putative [Ricinus communis] Length = 457 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D H V S+K+K+L+VFM+ LA+F+SLVAIYSDAYA+F +N P Sbjct: 413 DPHLVASKKDKVLSVFMIFLALFSSLVAIYSDAYALFRKNPSP 455 >ref|XP_006338315.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like isoform X1 [Solanum tuberosum] Length = 459 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/43 (53%), Positives = 38/43 (88%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D +G+ ++++KIL++FM+ LAVF+++VAIYSDAYA+F +N+ P Sbjct: 415 DRYGIATKRDKILSIFMIVLAVFSNMVAIYSDAYALFKKNSSP 457 >ref|XP_004232123.1| PREDICTED: sodium-coupled neutral amino acid transporter 3-like [Solanum lycopersicum] Length = 460 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/43 (53%), Positives = 38/43 (88%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D +G+ ++++KIL++FM+ LAVF+++VAIYSDAYA+F +N+ P Sbjct: 416 DRYGIATKRDKILSIFMIVLAVFSNMVAIYSDAYALFKKNSSP 458 >emb|CBI16906.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNA 192 D H + ++K+KILA FM+ LAVF++LVAIYSDAYA+F +N+ Sbjct: 298 DRHSIATKKDKILASFMIALAVFSNLVAIYSDAYALFKKNS 338 >ref|XP_002282329.1| PREDICTED: sodium-coupled neutral amino acid transporter 4 [Vitis vinifera] Length = 462 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNA 192 D H + ++K+KILA FM+ LAVF++LVAIYSDAYA+F +N+ Sbjct: 418 DRHSIATKKDKILASFMIALAVFSNLVAIYSDAYALFKKNS 458 >emb|CAN67024.1| hypothetical protein VITISV_036511 [Vitis vinifera] Length = 437 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNA 192 D H + ++K+KILA FM+ LAVF++LVAIYSDAYA+F +N+ Sbjct: 393 DRHSIATKKDKILASFMIALAVFSNLVAIYSDAYALFKKNS 433 >gb|EOY03853.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|508711957|gb|EOY03854.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 464 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRN 195 D H + ++K+KILA+FM+ LAVF++LVAIYSDAYA+F +N Sbjct: 418 DRHFIATKKDKILAIFMIVLAVFSNLVAIYSDAYALFKKN 457 >ref|XP_002534057.1| amino acid transporter, putative [Ricinus communis] gi|223525920|gb|EEF28328.1| amino acid transporter, putative [Ricinus communis] Length = 461 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D H + ++K+KIL++FM+ LAVF++ VAIYSDAYA+ +N+ P Sbjct: 417 DRHNIATKKDKILSIFMISLAVFSNAVAIYSDAYALIKKNSSP 459 >ref|XP_004297186.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Fragaria vesca subsp. vesca] Length = 453 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D HG+ + K+K L+VFM+GLAVF +L+AIYSDA A+ +N P Sbjct: 409 DRHGIATSKDKTLSVFMIGLAVFTNLIAIYSDAVALLKKNVSP 451 >ref|XP_006365650.1| PREDICTED: sodium-coupled neutral amino acid transporter 5-like [Solanum tuberosum] Length = 463 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/44 (50%), Positives = 37/44 (84%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPPS 183 D +G+ ++K+KIL +FM+ +AVF+++VAIYSDAY++ +N+ PS Sbjct: 419 DRYGIATKKDKILCIFMIVIAVFSNVVAIYSDAYSLIKKNSSPS 462 >ref|XP_004233397.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like isoform 1 [Solanum lycopersicum] gi|460375206|ref|XP_004233398.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like isoform 2 [Solanum lycopersicum] Length = 463 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/44 (50%), Positives = 37/44 (84%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPPS 183 D +G+ ++K+KIL +FM+ +AVF+++VAIYSDAY++ +N+ PS Sbjct: 419 DPYGIATKKDKILCIFMIVIAVFSNVVAIYSDAYSLIKKNSSPS 462 >gb|ADD54601.1| putative amino acid transporter [Linum usitatissimum] Length = 99 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D H + + K+K+L VFM+ LAVFA+ VAIYSDAYA+ RN+ P Sbjct: 54 DRHYIATSKDKMLCVFMIVLAVFANAVAIYSDAYALIKRNSSP 96 >ref|XP_002331285.1| amino acid transporter [Populus trichocarpa] gi|566166023|ref|XP_006384246.1| amino acid transporter family protein [Populus trichocarpa] gi|550340792|gb|ERP62043.1| amino acid transporter family protein [Populus trichocarpa] Length = 460 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = -3 Query: 314 DSHGVTSRKEKILAVFMVGLAVFASLVAIYSDAYAIFSRNAPP 186 D H + S+++KIL +FM+ LAVF++ VAIYSDAYA+ +N P Sbjct: 416 DRHNIASKRDKILCIFMIALAVFSNGVAIYSDAYALIKKNPSP 458