BLASTX nr result
ID: Rehmannia26_contig00021203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00021203 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P10978.1|POLX_TOBAC RecName: Full=Retrovirus-related Pol poly... 57 3e-06 >sp|P10978.1|POLX_TOBAC RecName: Full=Retrovirus-related Pol polyprotein from transposon TNT 1-94; Includes: RecName: Full=Protease; Includes: RecName: Full=Reverse transcriptase; Includes: RecName: Full=Endonuclease gi|20045|emb|CAA32025.1| unnamed protein product [Nicotiana tabacum] Length = 1328 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +2 Query: 2 KHIDILYHWIRETIDRQQLRLINIHTKENPSSMLTKVV 115 KHID+ YHWIRE +D + L+++ I T ENP+ MLTKVV Sbjct: 1274 KHIDVRYHWIREMVDDESLKVLKISTNENPADMLTKVV 1311