BLASTX nr result
ID: Rehmannia26_contig00020776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020776 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315124.1| hypothetical protein POPTR_0010s18960g [Popu... 57 2e-06 >ref|XP_002315124.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa] gi|222864164|gb|EEF01295.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa] Length = 150 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 338 PKNTDEGNFWISRASRTRASVWKVSNKRPGYN 243 PK+ ++G+ WISRAS+ RASVWKVSNKRPGYN Sbjct: 108 PKDVEKGSAWISRASKRRASVWKVSNKRPGYN 139