BLASTX nr result
ID: Rehmannia26_contig00020768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020768 (475 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 89 5e-16 gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] 88 1e-15 ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloro... 88 1e-15 ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloro... 88 1e-15 ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus... 88 1e-15 ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloro... 87 2e-15 gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlise... 86 4e-15 gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus... 85 1e-14 ref|XP_006399688.1| hypothetical protein EUTSA_v10014577mg [Eutr... 85 1e-14 emb|CBI14940.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255... 84 2e-14 ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] g... 84 2e-14 ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloro... 84 3e-14 gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilop... 84 3e-14 gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticu... 84 3e-14 gb|AFO66523.1| putative ribosomal protein L19 family protein [Br... 84 3e-14 gb|AFO66496.1| putative 50S ribosomal protein L19 [Brassica napus] 84 3e-14 ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloro... 84 3e-14 dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgar... 84 3e-14 gb|EMJ10674.1| hypothetical protein PRUPE_ppa010021mg [Prunus pe... 83 3e-14 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 344 GVG+ESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ Sbjct: 205 GVGVESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 248 >gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] Length = 187 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 344 GVG+ESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALK+Q Sbjct: 144 GVGVESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKRQ 187 >ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 189 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 344 GVGIESLFPLYSPNIKEIKVL+KKKVRRAKLYYLRDKMNALKKQ Sbjct: 146 GVGIESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKKQ 189 >ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 269 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 344 GVGIESLFPLYSPNIKEIKVL+KKKVRRAKLYYLRDKMNALKKQ Sbjct: 226 GVGIESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKKQ 269 >ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223550424|gb|EEF51911.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 190 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKQ 344 GVG+ESLFPLYSPNIKEI+VLDKKKVRRAKLYYLRDKMNALKKQ Sbjct: 147 GVGVESLFPLYSPNIKEIRVLDKKKVRRAKLYYLRDKMNALKKQ 190 >ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 242 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ESLFPLYSPNIKEIK+LDKKKVRRAKLYYLRDKMNALKK Sbjct: 199 GVGVESLFPLYSPNIKEIKILDKKKVRRAKLYYLRDKMNALKK 241 >gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlisea aurea] Length = 167 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVGIESLFPLYSPNIKEIKVL+KKKVRRAKLYYLRDKMNALKK Sbjct: 125 GVGIESLFPLYSPNIKEIKVLEKKKVRRAKLYYLRDKMNALKK 167 >gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus vulgaris] Length = 231 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALK 350 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRD+MNALK Sbjct: 189 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDRMNALK 230 >ref|XP_006399688.1| hypothetical protein EUTSA_v10014577mg [Eutrema salsugineum] gi|557100778|gb|ESQ41141.1| hypothetical protein EUTSA_v10014577mg [Eutrema salsugineum] Length = 230 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPN++EIKVLDKKKVRRAKLYYLRDKMNALKK Sbjct: 187 GVGVESMFPLYSPNLREIKVLDKKKVRRAKLYYLRDKMNALKK 229 >emb|CBI14940.3| unnamed protein product [Vitis vinifera] Length = 270 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ESLFPLYSP+IKEIKVLDKKKVRRAKLYYLRDKMNAL+K Sbjct: 228 GVGVESLFPLYSPSIKEIKVLDKKKVRRAKLYYLRDKMNALRK 270 >ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255272 [Vitis vinifera] Length = 243 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ESLFPLYSP+IKEIKVLDKKKVRRAKLYYLRDKMNAL+K Sbjct: 201 GVGVESLFPLYSPSIKEIKVLDKKKVRRAKLYYLRDKMNALRK 243 >ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] gi|46390526|dbj|BAD16014.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|51536266|dbj|BAD38434.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|113535776|dbj|BAF08159.1| Os02g0205000 [Oryza sativa Japonica Group] gi|125538542|gb|EAY84937.1| hypothetical protein OsI_06303 [Oryza sativa Indica Group] gi|125581228|gb|EAZ22159.1| hypothetical protein OsJ_05821 [Oryza sativa Japonica Group] gi|215707036|dbj|BAG93496.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765566|dbj|BAG87263.1| unnamed protein product [Oryza sativa Japonica Group] Length = 222 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIKVLD+KKVRRAKLYYLRD+MNALKK Sbjct: 180 GVGVESVFPLYSPNIKEIKVLDRKKVRRAKLYYLRDRMNALKK 222 >ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Oryza brachyantha] Length = 222 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIK+LD+KKVRRAKLYYLRD+MNALKK Sbjct: 180 GVGVESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 222 >gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilops tauschii] Length = 242 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIK+LD+KKVRRAKLYYLRD+MNALKK Sbjct: 200 GVGVESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 242 >gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticum urartu] Length = 217 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIK+LD+KKVRRAKLYYLRD+MNALKK Sbjct: 175 GVGVESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >gb|AFO66523.1| putative ribosomal protein L19 family protein [Brassica napus] Length = 127 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPN++EIKVLDKK+VRRAKLYYLRDKMNALKK Sbjct: 84 GVGVESMFPLYSPNLREIKVLDKKRVRRAKLYYLRDKMNALKK 126 >gb|AFO66496.1| putative 50S ribosomal protein L19 [Brassica napus] Length = 260 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPN++EIKVLDKK+VRRAKLYYLRDKMNALKK Sbjct: 217 GVGVESMFPLYSPNLREIKVLDKKRVRRAKLYYLRDKMNALKK 259 >ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 212 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIK+LD+KKVRRAKLYYLRD+MNALKK Sbjct: 170 GVGVESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 212 >dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326520856|dbj|BAJ92791.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 217 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ES+FPLYSPNIKEIK+LD+KKVRRAKLYYLRD+MNALKK Sbjct: 175 GVGVESVFPLYSPNIKEIKILDRKKVRRAKLYYLRDRMNALKK 217 >gb|EMJ10674.1| hypothetical protein PRUPE_ppa010021mg [Prunus persica] Length = 267 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 475 GVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 347 GVG+ESL PLYSPNIKEIKVLDKK+VRRAKLYY+RDKMNALKK Sbjct: 225 GVGVESLLPLYSPNIKEIKVLDKKRVRRAKLYYIRDKMNALKK 267