BLASTX nr result
ID: Rehmannia26_contig00020540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020540 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlise... 62 8e-08 >gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlisea aurea] Length = 355 Score = 62.0 bits (149), Expect = 8e-08 Identities = 40/84 (47%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -2 Query: 285 MKSEPGLEIESLGRLQGFWTGSSDPTRLESNGSEWVDYCNVSRVRPSEANGFAVCTRNKR 106 MK E G EIE G +G DP R + S+W+D C SRVR SEA GFAV TR KR Sbjct: 1 MKPELGSEIECSGPSKGSDEQQPDPARDNLDDSDWLDRCYTSRVRESEAKGFAVYTRKKR 60 Query: 105 SKS-KIVCRGGYLDKLQGDSGVLV 37 KS ++ + K Q DS VLV Sbjct: 61 LKSAEVGATVCFEKKNQSDSRVLV 84