BLASTX nr result
ID: Rehmannia26_contig00020281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020281 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY33234.1| RING-H2 group F2A isoform 2 [Theobroma cacao] 111 1e-22 gb|EOY33233.1| RING-H2 group F2A isoform 1 [Theobroma cacao] 111 1e-22 ref|XP_002270570.2| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 110 1e-22 emb|CBI39117.3| unnamed protein product [Vitis vinifera] 110 1e-22 ref|XP_002322768.2| hypothetical protein POPTR_0016s06670g [Popu... 110 3e-22 gb|EMJ06523.1| hypothetical protein PRUPE_ppa006952mg [Prunus pe... 109 3e-22 ref|XP_004979528.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 109 4e-22 ref|XP_004979525.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 109 4e-22 ref|XP_002277399.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 109 4e-22 ref|XP_006424050.1| hypothetical protein CICLE_v10030283mg [Citr... 108 6e-22 ref|XP_004487435.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 108 6e-22 gb|EXB39672.1| hypothetical protein L484_017147 [Morus notabilis] 108 7e-22 ref|XP_004167871.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 108 1e-21 ref|XP_004136533.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 108 1e-21 gb|EXC26396.1| E3 ubiquitin-protein ligase RHF2A [Morus notabilis] 107 1e-21 ref|XP_006487825.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 107 1e-21 ref|XP_004295149.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A... 107 2e-21 ref|XP_003596933.1| RING finger protein [Medicago truncatula] gi... 106 3e-21 ref|XP_003596935.1| RING finger protein [Medicago truncatula] gi... 106 3e-21 ref|XP_002524095.1| protein binding protein, putative [Ricinus c... 106 3e-21 >gb|EOY33234.1| RING-H2 group F2A isoform 2 [Theobroma cacao] Length = 385 Score = 111 bits (277), Expect = 1e-22 Identities = 54/69 (78%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDAELE+RIIQHLAAAAAMGR I RREG RSR+SA RPQF+V Sbjct: 107 PTLGDFELQHLPVGANDAELEERIIQHLAAAAAMGRARHIARREGLRSRSSAQGRPQFLV 166 Query: 182 LSAHPNGSS 208 S HPN S Sbjct: 167 FSTHPNAPS 175 >gb|EOY33233.1| RING-H2 group F2A isoform 1 [Theobroma cacao] Length = 388 Score = 111 bits (277), Expect = 1e-22 Identities = 54/69 (78%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDAELE+RIIQHLAAAAAMGR I RREG RSR+SA RPQF+V Sbjct: 110 PTLGDFELQHLPVGANDAELEERIIQHLAAAAAMGRARHIARREGLRSRSSAQGRPQFLV 169 Query: 182 LSAHPNGSS 208 S HPN S Sbjct: 170 FSTHPNAPS 178 >ref|XP_002270570.2| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Vitis vinifera] Length = 387 Score = 110 bits (276), Expect = 1e-22 Identities = 52/69 (75%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG ND ELE+RIIQHLAAAAAMGR H I RREG RSR+SAH R F+V Sbjct: 112 PTLGDFELQHLPVGTNDPELEERIIQHLAAAAAMGRAHHIARREGQRSRSSAHGRSHFLV 171 Query: 182 LSAHPNGSS 208 S HPN ++ Sbjct: 172 FSTHPNATA 180 >emb|CBI39117.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 110 bits (276), Expect = 1e-22 Identities = 52/69 (75%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG ND ELE+RIIQHLAAAAAMGR H I RREG RSR+SAH R F+V Sbjct: 112 PTLGDFELQHLPVGTNDPELEERIIQHLAAAAAMGRAHHIARREGQRSRSSAHGRSHFLV 171 Query: 182 LSAHPNGSS 208 S HPN ++ Sbjct: 172 FSTHPNATA 180 >ref|XP_002322768.2| hypothetical protein POPTR_0016s06670g [Populus trichocarpa] gi|550320995|gb|EEF04529.2| hypothetical protein POPTR_0016s06670g [Populus trichocarpa] Length = 392 Score = 110 bits (274), Expect = 3e-22 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVGV+D+ELE+RIIQHLAAAAAMGRT GRREG R+RTS+H RP F+V Sbjct: 113 PTLGDFELQHLPVGVSDSELEERIIQHLAAAAAMGRTRHFGRREGQRNRTSSHGRPHFLV 172 Query: 182 LSAHP 196 S HP Sbjct: 173 FSTHP 177 >gb|EMJ06523.1| hypothetical protein PRUPE_ppa006952mg [Prunus persica] Length = 389 Score = 109 bits (273), Expect = 3e-22 Identities = 52/66 (78%), Positives = 56/66 (84%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVGVNDAELE+RIIQHLAAAAAMGR I RREG R+R+S RPQF+V Sbjct: 113 PTLGDFELQHLPVGVNDAELEERIIQHLAAAAAMGRARHIARREGQRNRSSTQGRPQFLV 172 Query: 182 LSAHPN 199 S HPN Sbjct: 173 FSTHPN 178 >ref|XP_004979528.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like isoform X4 [Setaria italica] Length = 391 Score = 109 bits (272), Expect = 4e-22 Identities = 51/69 (73%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 P LGDFELQHLPV NDAELE+RI+QHLAAAAAMGR H +GRREG R R+ +H RPQF+V Sbjct: 111 PALGDFELQHLPVVGNDAELEERILQHLAAAAAMGRAHHLGRREGHRGRSGSHGRPQFLV 170 Query: 182 LSAHPNGSS 208 SAHPN S Sbjct: 171 FSAHPNSPS 179 >ref|XP_004979525.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like isoform X1 [Setaria italica] gi|514809400|ref|XP_004979526.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like isoform X2 [Setaria italica] gi|514809402|ref|XP_004979527.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like isoform X3 [Setaria italica] Length = 416 Score = 109 bits (272), Expect = 4e-22 Identities = 51/69 (73%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 P LGDFELQHLPV NDAELE+RI+QHLAAAAAMGR H +GRREG R R+ +H RPQF+V Sbjct: 136 PALGDFELQHLPVVGNDAELEERILQHLAAAAAMGRAHHLGRREGHRGRSGSHGRPQFLV 195 Query: 182 LSAHPNGSS 208 SAHPN S Sbjct: 196 FSAHPNSPS 204 >ref|XP_002277399.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A [Vitis vinifera] gi|296084011|emb|CBI24399.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 109 bits (272), Expect = 4e-22 Identities = 52/66 (78%), Positives = 57/66 (86%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDAELE+RIIQHLAAAAAMGR I RREG R+R+SA RPQF+V Sbjct: 113 PTLGDFELQHLPVGANDAELEERIIQHLAAAAAMGRARHIARREGQRTRSSAQGRPQFLV 172 Query: 182 LSAHPN 199 SAHP+ Sbjct: 173 FSAHPS 178 >ref|XP_006424050.1| hypothetical protein CICLE_v10030283mg [Citrus clementina] gi|557525984|gb|ESR37290.1| hypothetical protein CICLE_v10030283mg [Citrus clementina] Length = 386 Score = 108 bits (271), Expect = 6e-22 Identities = 52/69 (75%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDAELE+RIIQHLAAAAAMGR I RRE RSR S+ ARPQF+V Sbjct: 109 PTLGDFELQHLPVGANDAELEERIIQHLAAAAAMGRARHIARRESHRSRASSQARPQFLV 168 Query: 182 LSAHPNGSS 208 S HPN ++ Sbjct: 169 FSTHPNAAN 177 >ref|XP_004487435.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Cicer arietinum] Length = 394 Score = 108 bits (271), Expect = 6e-22 Identities = 51/66 (77%), Positives = 57/66 (86%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDA+LE+RIIQHLAAAAAMGR I RREG R+R+SA RPQ++V Sbjct: 115 PTLGDFELQHLPVGANDADLEERIIQHLAAAAAMGRARHIARREGQRNRSSAQGRPQYLV 174 Query: 182 LSAHPN 199 SAHPN Sbjct: 175 FSAHPN 180 >gb|EXB39672.1| hypothetical protein L484_017147 [Morus notabilis] Length = 560 Score = 108 bits (270), Expect = 7e-22 Identities = 52/69 (75%), Positives = 56/69 (81%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG +DAELE+RIIQHLAAAAAMGR I RREG R+R SA RPQF+V Sbjct: 208 PTLGDFELQHLPVGASDAELEERIIQHLAAAAAMGRARHISRREGQRNRASAQGRPQFLV 267 Query: 182 LSAHPNGSS 208 S HPN S Sbjct: 268 FSTHPNAPS 276 >ref|XP_004167871.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Cucumis sativus] Length = 371 Score = 108 bits (269), Expect = 1e-21 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 P LG+FELQHLP+GVN+AELE+RIIQHLAAAAAMGRTH IGRREG RSR+S+H RP F+V Sbjct: 108 PALGNFELQHLPLGVNNAELEERIIQHLAAAAAMGRTHHIGRREG-RSRSSSHGRPHFLV 166 Query: 182 LSAHPNG 202 S HP G Sbjct: 167 FSTHPGG 173 >ref|XP_004136533.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Cucumis sativus] Length = 371 Score = 108 bits (269), Expect = 1e-21 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 P LG+FELQHLP+GVN+AELE+RIIQHLAAAAAMGRTH IGRREG RSR+S+H RP F+V Sbjct: 108 PALGNFELQHLPLGVNNAELEERIIQHLAAAAAMGRTHHIGRREG-RSRSSSHGRPHFLV 166 Query: 182 LSAHPNG 202 S HP G Sbjct: 167 FSTHPGG 173 >gb|EXC26396.1| E3 ubiquitin-protein ligase RHF2A [Morus notabilis] Length = 379 Score = 107 bits (268), Expect = 1e-21 Identities = 49/69 (71%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDA+LE+RIIQHLAAAAAMGR H + RR+ R R+SAH RP F+V Sbjct: 108 PTLGDFELQHLPVGANDADLEERIIQHLAAAAAMGRAHHVHRRDSQRGRSSAHGRPHFLV 167 Query: 182 LSAHPNGSS 208 S HP+ +S Sbjct: 168 FSTHPSAAS 176 >ref|XP_006487825.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Citrus sinensis] Length = 386 Score = 107 bits (268), Expect = 1e-21 Identities = 51/69 (73%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDAELE+RIIQHLAAAAAMGR I RRE R+R S+ ARPQF+V Sbjct: 109 PTLGDFELQHLPVGANDAELEERIIQHLAAAAAMGRARHIARRESHRNRASSQARPQFLV 168 Query: 182 LSAHPNGSS 208 S HPN ++ Sbjct: 169 FSTHPNAAN 177 >ref|XP_004295149.1| PREDICTED: E3 ubiquitin-protein ligase RHF2A-like [Fragaria vesca subsp. vesca] Length = 387 Score = 107 bits (267), Expect = 2e-21 Identities = 51/65 (78%), Positives = 55/65 (84%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVGVNDAELE+RIIQHLAAAAAMGR I RREG R+R+S RPQF+V Sbjct: 114 PTLGDFELQHLPVGVNDAELEERIIQHLAAAAAMGRARHIARREGQRNRSSGQGRPQFLV 173 Query: 182 LSAHP 196 S HP Sbjct: 174 FSTHP 178 >ref|XP_003596933.1| RING finger protein [Medicago truncatula] gi|355485981|gb|AES67184.1| RING finger protein [Medicago truncatula] Length = 382 Score = 106 bits (265), Expect = 3e-21 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDA+LE+RI+QH AAAAAMGR I RREG R+R+SA RPQ++V Sbjct: 115 PTLGDFELQHLPVGANDADLEERILQHFAAAAAMGRARHIARREGQRNRSSAQGRPQYMV 174 Query: 182 LSAHPN 199 SAHPN Sbjct: 175 FSAHPN 180 >ref|XP_003596935.1| RING finger protein [Medicago truncatula] gi|355485983|gb|AES67186.1| RING finger protein [Medicago truncatula] Length = 383 Score = 106 bits (265), Expect = 3e-21 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG NDA+LE+RI+QH AAAAAMGR I RREG R+R+SA RPQ++V Sbjct: 115 PTLGDFELQHLPVGANDADLEERILQHFAAAAAMGRARHIARREGQRNRSSAQGRPQYMV 174 Query: 182 LSAHPN 199 SAHPN Sbjct: 175 FSAHPN 180 >ref|XP_002524095.1| protein binding protein, putative [Ricinus communis] gi|223536663|gb|EEF38305.1| protein binding protein, putative [Ricinus communis] Length = 378 Score = 106 bits (265), Expect = 3e-21 Identities = 49/69 (71%), Positives = 57/69 (82%) Frame = +2 Query: 2 PTLGDFELQHLPVGVNDAELEDRIIQHLAAAAAMGRTHRIGRREGSRSRTSAHARPQFVV 181 PTLGDFELQHLPVG +D++LE+RIIQHLAAAAAMGR H GRREG R+R S+H RP F+V Sbjct: 114 PTLGDFELQHLPVGASDSDLEERIIQHLAAAAAMGRGHHFGRREGHRNRQSSHGRPHFLV 173 Query: 182 LSAHPNGSS 208 S HP+ S Sbjct: 174 FSTHPSAPS 182