BLASTX nr result
ID: Rehmannia26_contig00020224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020224 (661 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70140.1| hypothetical protein M569_04617, partial [Genlise... 48 9e-06 >gb|EPS70140.1| hypothetical protein M569_04617, partial [Genlisea aurea] Length = 918 Score = 48.1 bits (113), Expect(2) = 9e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 568 VEEGRVASFLLATTAILQLRYAIMKKMMLLE 660 +EEGRVASFLLATTA+LQLR AI KK ++LE Sbjct: 531 LEEGRVASFLLATTALLQLRIAISKKTVILE 561 Score = 27.7 bits (60), Expect(2) = 9e-06 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +3 Query: 399 TLMSIIVMIRAWSFLSNSFI 458 TL ++V+IR++S LSNSFI Sbjct: 511 TLAGLMVLIRSFSLLSNSFI 530