BLASTX nr result
ID: Rehmannia26_contig00020112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00020112 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24196.1| E3 ubiquitin-protein ligase PRT1 [Morus notabilis] 108 1e-21 gb|EPS70721.1| hypothetical protein M569_04044, partial [Genlise... 104 1e-20 ref|XP_004290215.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 103 2e-20 ref|XP_002266086.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 100 2e-19 ref|XP_004139635.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 100 3e-19 gb|AFK45695.1| unknown [Medicago truncatula] 99 4e-19 ref|XP_003622926.1| E3 ubiquitin-protein ligase PRT1 [Medicago t... 99 4e-19 ref|XP_002301781.1| predicted protein [Populus trichocarpa] 99 6e-19 gb|ABK94910.1| unknown [Populus trichocarpa] 99 6e-19 ref|XP_004506595.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 99 8e-19 ref|XP_006602531.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 98 1e-18 ref|XP_006586252.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 98 1e-18 ref|XP_006479296.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 98 1e-18 ref|XP_006479295.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 98 1e-18 ref|XP_006443611.1| hypothetical protein CICLE_v10023514mg [Citr... 98 1e-18 ref|XP_003551419.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 98 1e-18 gb|ESW12589.1| hypothetical protein PHAVU_008G125500g [Phaseolus... 97 2e-18 gb|ESW12588.1| hypothetical protein PHAVU_008G125500g [Phaseolus... 97 2e-18 ref|XP_006297663.1| hypothetical protein CARUB_v10013687mg, part... 97 2e-18 ref|XP_006418691.1| hypothetical protein EUTSA_v10002569mg [Eutr... 97 2e-18 >gb|EXC24196.1| E3 ubiquitin-protein ligase PRT1 [Morus notabilis] Length = 636 Score = 108 bits (269), Expect = 1e-21 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 K SE+FVCCVC DLLYKP+VL+CGHISCFWCVHKSM GL +SRCPICRN Y HF Sbjct: 13 KISESFVCCVCLDLLYKPIVLSCGHISCFWCVHKSMDGLRESRCPICRNPYNHF 66 >gb|EPS70721.1| hypothetical protein M569_04044, partial [Genlisea aurea] Length = 331 Score = 104 bits (259), Expect = 1e-20 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = +2 Query: 209 SEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 +E+F+CCVC +LLYKPV+LACGH+SCFWCVHKSMS L KS CP+CR+QYYHF Sbjct: 15 NESFMCCVCLELLYKPVILACGHMSCFWCVHKSMSSLQKSHCPLCRSQYYHF 66 >ref|XP_004290215.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Fragaria vesca subsp. vesca] Length = 306 Score = 103 bits (258), Expect = 2e-20 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = +2 Query: 206 FSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 FSE F+CCVC DLLYKP+VL+CGHI+CFWCVH+SM+G HKS CP+CR+ Y+HF Sbjct: 16 FSERFLCCVCLDLLYKPIVLSCGHITCFWCVHRSMNGKHKSHCPLCRHPYHHF 68 >ref|XP_002266086.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Vitis vinifera] Length = 470 Score = 100 bits (250), Expect = 2e-19 Identities = 40/54 (74%), Positives = 44/54 (81%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 + S +F CCVC DLLYKP+VLACGHISCFWCVH SM G H+S CPICRN Y HF Sbjct: 17 EISRSFTCCVCLDLLYKPIVLACGHISCFWCVHYSMDGAHESHCPICRNPYSHF 70 >ref|XP_004139635.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Cucumis sativus] Length = 359 Score = 99.8 bits (247), Expect = 3e-19 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +2 Query: 209 SEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++AF+CCVC DLLYKP+VL CGHISCFWCVHK M+G +S CPICR YYHF Sbjct: 12 ADAFLCCVCLDLLYKPIVLPCGHISCFWCVHKCMNGFRESHCPICRRSYYHF 63 >gb|AFK45695.1| unknown [Medicago truncatula] Length = 410 Score = 99.4 bits (246), Expect = 4e-19 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++F CCVC DLLYKP+VL+CGH+ CFWC+HKSMSG+ +S+CP CR+QYYHF Sbjct: 20 DSFCCCVCLDLLYKPIVLSCGHMRCFWCIHKSMSGVRESKCPTCRHQYYHF 70 >ref|XP_003622926.1| E3 ubiquitin-protein ligase PRT1 [Medicago truncatula] gi|355497941|gb|AES79144.1| E3 ubiquitin-protein ligase PRT1 [Medicago truncatula] Length = 452 Score = 99.4 bits (246), Expect = 4e-19 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++F CCVC DLLYKP+VL+CGH+ CFWC+HKSMSG+ +S+CP CR+QYYHF Sbjct: 20 DSFCCCVCLDLLYKPIVLSCGHMCCFWCIHKSMSGVRESKCPTCRHQYYHF 70 >ref|XP_002301781.1| predicted protein [Populus trichocarpa] Length = 382 Score = 99.0 bits (245), Expect = 6e-19 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 +FS++F C VC DLLYKP+VL+CGHISCFWCVHKSMSGL +S CPICR+ Y HF Sbjct: 19 EFSDSFRCSVCLDLLYKPIVLSCGHISCFWCVHKSMSGLRESNCPICRHPYNHF 72 >gb|ABK94910.1| unknown [Populus trichocarpa] Length = 469 Score = 99.0 bits (245), Expect = 6e-19 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 +FS++F C VC DLLYKP+VL+CGHISCFWCVHKSMSGL +S CPICR+ Y HF Sbjct: 32 EFSDSFRCSVCLDLLYKPIVLSCGHISCFWCVHKSMSGLRESNCPICRHPYNHF 85 >ref|XP_004506595.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Cicer arietinum] Length = 399 Score = 98.6 bits (244), Expect = 8e-19 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 E+FVCCVC DLLYKP+VL+CGH+SCFWCVHKSM+ +S CPICR+ YYHF Sbjct: 21 ESFVCCVCLDLLYKPIVLSCGHVSCFWCVHKSMNRSRESHCPICRHGYYHF 71 >ref|XP_006602531.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like isoform X2 [Glycine max] Length = 394 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++FVCCVC DLLYKP+VL+CGHI CFWCV+ SM+ L +S+CP+CRNQYYHF Sbjct: 21 DSFVCCVCLDLLYKPIVLSCGHICCFWCVYNSMNCLRESQCPVCRNQYYHF 71 >ref|XP_006586252.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Glycine max] Length = 421 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++FVCCVC DLLYKP+VL+CGH+ CFWCV+ SMS L +S+CP+CRNQYYHF Sbjct: 21 DSFVCCVCLDLLYKPIVLSCGHMCCFWCVYNSMSCLRESQCPVCRNQYYHF 71 >ref|XP_006479296.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like isoform X4 [Citrus sinensis] Length = 366 Score = 98.2 bits (243), Expect = 1e-18 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 K S +F CC+C DLLYKP+VL+CGHISCFWCVH+SM+GL +S CPICR Y HF Sbjct: 17 KISHSFRCCICLDLLYKPIVLSCGHISCFWCVHRSMNGLRESHCPICRRPYNHF 70 >ref|XP_006479295.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like isoform X3 [Citrus sinensis] Length = 378 Score = 98.2 bits (243), Expect = 1e-18 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 K S +F CC+C DLLYKP+VL+CGHISCFWCVH+SM+GL +S CPICR Y HF Sbjct: 17 KISHSFRCCICLDLLYKPIVLSCGHISCFWCVHRSMNGLRESHCPICRRPYNHF 70 >ref|XP_006443611.1| hypothetical protein CICLE_v10023514mg [Citrus clementina] gi|568851223|ref|XP_006479293.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like isoform X1 [Citrus sinensis] gi|557545873|gb|ESR56851.1| hypothetical protein CICLE_v10023514mg [Citrus clementina] Length = 440 Score = 98.2 bits (243), Expect = 1e-18 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 K S +F CC+C DLLYKP+VL+CGHISCFWCVH+SM+GL +S CPICR Y HF Sbjct: 17 KISHSFRCCICLDLLYKPIVLSCGHISCFWCVHRSMNGLRESHCPICRRPYNHF 70 >ref|XP_003551419.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like isoform X1 [Glycine max] Length = 421 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 ++FVCCVC DLLYKP+VL+CGHI CFWCV+ SM+ L +S+CP+CRNQYYHF Sbjct: 21 DSFVCCVCLDLLYKPIVLSCGHICCFWCVYNSMNCLRESQCPVCRNQYYHF 71 >gb|ESW12589.1| hypothetical protein PHAVU_008G125500g [Phaseolus vulgaris] Length = 323 Score = 97.4 bits (241), Expect = 2e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 E+FVCCVC DLLYKP+VL+CGHI CFWCV+ SM+ L +S+CP+CR+QYYHF Sbjct: 21 ESFVCCVCLDLLYKPIVLSCGHICCFWCVYNSMNCLRESQCPVCRHQYYHF 71 >gb|ESW12588.1| hypothetical protein PHAVU_008G125500g [Phaseolus vulgaris] Length = 418 Score = 97.4 bits (241), Expect = 2e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 212 EAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 E+FVCCVC DLLYKP+VL+CGHI CFWCV+ SM+ L +S+CP+CR+QYYHF Sbjct: 21 ESFVCCVCLDLLYKPIVLSCGHICCFWCVYNSMNCLRESQCPVCRHQYYHF 71 >ref|XP_006297663.1| hypothetical protein CARUB_v10013687mg, partial [Capsella rubella] gi|482566372|gb|EOA30561.1| hypothetical protein CARUB_v10013687mg, partial [Capsella rubella] Length = 451 Score = 97.4 bits (241), Expect = 2e-18 Identities = 36/54 (66%), Positives = 47/54 (87%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 + S+ F+CCVC +LLYKP+VL+CGH+SCFWCVHKSM+G+ +S CPICR+ Y HF Sbjct: 46 EISDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGIRESHCPICRDPYVHF 99 >ref|XP_006418691.1| hypothetical protein EUTSA_v10002569mg [Eutrema salsugineum] gi|557096619|gb|ESQ37127.1| hypothetical protein EUTSA_v10002569mg [Eutrema salsugineum] Length = 379 Score = 97.1 bits (240), Expect = 2e-18 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = +2 Query: 203 KFSEAFVCCVCRDLLYKPVVLACGHISCFWCVHKSMSGLHKSRCPICRNQYYHF 364 + S+ F+CCVC ++LYKP+VL+CGH+SCFWCVH SM+GL KS CPICR+ Y HF Sbjct: 14 EISDKFLCCVCLEILYKPIVLSCGHLSCFWCVHNSMNGLRKSHCPICRDPYVHF 67