BLASTX nr result
ID: Rehmannia26_contig00019665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019665 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 71 2e-10 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 70 4e-10 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 69 6e-10 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 68 1e-09 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 68 1e-09 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 67 2e-09 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 67 2e-09 ref|XP_002529620.1| calcium-dependent protein kinase, putative [... 67 2e-09 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 66 4e-09 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 66 5e-09 ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase ... 65 7e-09 dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] 65 7e-09 gb|AFV29350.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29312.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29304.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29292.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29281.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29280.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 gb|AFV29278.1| calcium-dependent protein kinase-like protein, pa... 65 1e-08 ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Ci... 64 2e-08 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLM+DGSLQM+NEGR Sbjct: 500 TDWRKASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRERYN+LSLKLMKDGSLQMSNE R Sbjct: 496 TDWRKASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSLQM+NE R Sbjct: 501 TDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPR 535 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKL+KDGSLQ +NEGR Sbjct: 495 TDWRKASRQYSRERFNNLSLKLIKDGSLQSANEGR 529 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+N+LSLKLM+DGSLQ++NEGR Sbjct: 498 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEG 128 TDWRKASRQYSRER+NNLSLKLMKDGSLQM+N G Sbjct: 497 TDWRKASRQYSRERFNNLSLKLMKDGSLQMNNGG 530 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++++EGR Sbjct: 498 TDWRKASRQYSRERFNNLSLKLMKDGSLKLTSEGR 532 >ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530905|gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 529 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSLQM NEGR Sbjct: 496 TDWRKASRQYSRERFNNLSLKLMKDGSLQM-NEGR 529 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+N+LSLKLM+DGSL+++NEGR Sbjct: 494 TDWRKASRQYSRERFNSLSLKLMRDGSLKLANEGR 528 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEG 128 TDWRKASRQYSRER+N+LSLKLM+DGSLQ++NEG Sbjct: 498 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEG 531 >ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria vesca subsp. vesca] Length = 532 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 35/35 (100%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+N++SLKLM++GSLQ++NEGR Sbjct: 498 TDWRKASRQYSRERFNSISLKLMREGSLQLTNEGR 532 >dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] Length = 531 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER++NLSLKLMKDGSLQ++NE R Sbjct: 497 TDWRKASRQYSRERFSNLSLKLMKDGSLQLNNEVR 531 >gb|AFV29350.1| calcium-dependent protein kinase-like protein, partial [Senecio vulgaris] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29312.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188907|gb|AFV29313.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188913|gb|AFV29316.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188915|gb|AFV29317.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188917|gb|AFV29318.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188919|gb|AFV29319.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188921|gb|AFV29320.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188923|gb|AFV29321.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188925|gb|AFV29322.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188927|gb|AFV29323.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188933|gb|AFV29326.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188935|gb|AFV29327.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188953|gb|AFV29336.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188955|gb|AFV29337.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188961|gb|AFV29340.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29304.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188891|gb|AFV29305.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188929|gb|AFV29324.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29292.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188867|gb|AFV29293.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29281.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188845|gb|AFV29282.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188847|gb|AFV29283.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188887|gb|AFV29303.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188931|gb|AFV29325.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188957|gb|AFV29338.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188959|gb|AFV29339.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188963|gb|AFV29341.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29280.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29278.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188839|gb|AFV29279.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188849|gb|AFV29284.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188851|gb|AFV29285.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188853|gb|AFV29286.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188855|gb|AFV29287.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188857|gb|AFV29288.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188859|gb|AFV29289.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188861|gb|AFV29290.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188863|gb|AFV29291.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188869|gb|AFV29294.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188871|gb|AFV29295.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188873|gb|AFV29296.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188875|gb|AFV29297.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188877|gb|AFV29298.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188879|gb|AFV29299.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188881|gb|AFV29300.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188883|gb|AFV29301.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188885|gb|AFV29302.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188893|gb|AFV29306.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188895|gb|AFV29307.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188897|gb|AFV29308.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188899|gb|AFV29309.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188901|gb|AFV29310.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188903|gb|AFV29311.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188909|gb|AFV29314.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188911|gb|AFV29315.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188937|gb|AFV29328.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188939|gb|AFV29329.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188941|gb|AFV29330.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188943|gb|AFV29331.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188945|gb|AFV29332.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188947|gb|AFV29333.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188949|gb|AFV29334.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188951|gb|AFV29335.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188965|gb|AFV29342.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188967|gb|AFV29343.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188969|gb|AFV29344.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188971|gb|AFV29345.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188973|gb|AFV29346.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188975|gb|AFV29347.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188977|gb|AFV29348.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188979|gb|AFV29349.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+NNLSLKLMKDGSL++ NE + Sbjct: 111 TDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Cicer arietinum] gi|59709749|gb|AAP72282.2| calcium-dependent calmodulin-independent protein kinase isoform 2 [Cicer arietinum] Length = 540 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 27 TDWRKASRQYSRERYNNLSLKLMKDGSLQMSNEGR 131 TDWRKASRQYSRER+N+LSLKLM+DGSLQ++NE + Sbjct: 504 TDWRKASRQYSRERFNSLSLKLMRDGSLQLTNENQ 538