BLASTX nr result
ID: Rehmannia26_contig00019601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019601 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O24661.3|ASNS_TRIVS RecName: Full=Asparagine synthetase [glut... 55 9e-06 >sp|O24661.3|ASNS_TRIVS RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; AltName: Full=Glutamine-dependent asparagine synthetase gi|2429280|gb|AAD05033.1| asparagine synthetase [Triphysaria versicolor] gi|2429282|gb|AAD05034.1| asparagine synthetase [Triphysaria versicolor] gi|2429284|gb|AAD05035.1| asparagine synthetase [Triphysaria versicolor] Length = 586 Score = 55.1 bits (131), Expect = 9e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +2 Query: 2 RAAIGVHDSAYENHLPNGTLTSNIMDSVPVSLTNGLSPPELTIRS 136 RAA GVHD AYENH+P G L S MDS VSL N + P ELTIRS Sbjct: 544 RAATGVHDLAYENHVPIGNLKSKKMDS--VSLGNAVGPQELTIRS 586