BLASTX nr result
ID: Rehmannia26_contig00019510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019510 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305356.1| PREDICTED: BTB/POZ domain-containing protein... 80 4e-13 emb|CBI30274.3| unnamed protein product [Vitis vinifera] 76 4e-12 ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein... 76 4e-12 gb|EOY08167.1| Ubiquitin-protein ligases, putative isoform 3 [Th... 69 8e-10 gb|EOY08166.1| BTB/POZ domain-containing protein FBL11, putative... 69 8e-10 gb|EOY08165.1| BTB/POZ domain-containing protein FBL11, putative... 69 8e-10 ref|XP_006338937.1| PREDICTED: BTB/POZ domain-containing protein... 65 7e-09 ref|XP_006338936.1| PREDICTED: BTB/POZ domain-containing protein... 65 7e-09 ref|XP_006430266.1| hypothetical protein CICLE_v10013912mg [Citr... 65 7e-09 ref|XP_006430265.1| hypothetical protein CICLE_v10013912mg [Citr... 65 7e-09 gb|EMJ04427.1| hypothetical protein PRUPE_ppa000908mg [Prunus pe... 65 9e-09 ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein... 64 2e-08 ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein... 64 2e-08 ref|XP_004494153.1| PREDICTED: BTB/POZ domain-containing protein... 64 3e-08 ref|XP_004249559.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 ref|XP_006577063.1| PREDICTED: BTB/POZ domain-containing protein... 61 1e-07 ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FB... 59 9e-07 gb|ESW34864.1| hypothetical protein PHAVU_001G1880001g [Phaseolu... 57 3e-06 gb|EXB37743.1| hypothetical protein L484_013781 [Morus notabilis] 57 3e-06 >ref|XP_004305356.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Fragaria vesca subsp. vesca] Length = 920 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRYFL VKIARCK ++ LD+ +EARR PVHKETLV+VWNS+ + RTVVKERL Sbjct: 864 YADRYFLSTVKIARCKSQRYGLDVQFVEARRRPVHKETLVVVWNSKTISRTVVKERL 920 >emb|CBI30274.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/63 (63%), Positives = 47/63 (74%), Gaps = 6/63 (9%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARR------NPVHKETLVLVWNSEKLVRTVVK 180 ++DRY L IVKIARCK RK TL+L L+A R PVHKETLVLVW+S+ L RTVVK Sbjct: 948 YADRYSLSIVKIARCKFRKCTLELQILDATRRPVHMERPVHKETLVLVWSSKNLTRTVVK 1007 Query: 179 ERL 171 ER+ Sbjct: 1008 ERI 1010 >ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Vitis vinifera] Length = 980 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/63 (63%), Positives = 47/63 (74%), Gaps = 6/63 (9%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARR------NPVHKETLVLVWNSEKLVRTVVK 180 ++DRY L IVKIARCK RK TL+L L+A R PVHKETLVLVW+S+ L RTVVK Sbjct: 918 YADRYSLSIVKIARCKFRKCTLELQILDATRRPVHMERPVHKETLVLVWSSKNLTRTVVK 977 Query: 179 ERL 171 ER+ Sbjct: 978 ERI 980 >gb|EOY08167.1| Ubiquitin-protein ligases, putative isoform 3 [Theobroma cacao] Length = 654 Score = 68.6 bits (166), Expect = 8e-10 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 338 SDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 +DRY L VKIARCK ++ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 599 ADRYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 654 >gb|EOY08166.1| BTB/POZ domain-containing protein FBL11, putative isoform 2 [Theobroma cacao] Length = 715 Score = 68.6 bits (166), Expect = 8e-10 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 338 SDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 +DRY L VKIARCK ++ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 660 ADRYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 715 >gb|EOY08165.1| BTB/POZ domain-containing protein FBL11, putative isoform 1 [Theobroma cacao] Length = 935 Score = 68.6 bits (166), Expect = 8e-10 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 338 SDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 +DRY L VKIARCK ++ + + EA R PVH+ETLVLVWNS + RTVVKERL Sbjct: 880 ADRYCLRSVKIARCKSQRCNVGPYFAEAHRKPVHRETLVLVWNSRNVFRTVVKERL 935 >ref|XP_006338937.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X2 [Solanum tuberosum] Length = 810 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 F DR FL IVKIARC L++ TL PVH ETL+L W+S KL RTVVKERL Sbjct: 754 FPDRNFLHIVKIARCNLKRRTLGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 810 >ref|XP_006338936.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Solanum tuberosum] Length = 963 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 F DR FL IVKIARC L++ TL PVH ETL+L W+S KL RTVVKERL Sbjct: 907 FPDRNFLHIVKIARCNLKRRTLGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 963 >ref|XP_006430266.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] gi|557532323|gb|ESR43506.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 171 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/59 (62%), Positives = 45/59 (76%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNL-EARR-NPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRY L VKI +CK + L HNL EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 114 YADRYSLSTVKITKCKSKNRNL-CHNLSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 171 >ref|XP_006430265.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] gi|557532322|gb|ESR43505.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 148 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/59 (62%), Positives = 45/59 (76%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNL-EARR-NPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRY L VKI +CK + L HNL EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 91 YADRYSLSTVKITKCKSKNRNL-CHNLSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 148 >gb|EMJ04427.1| hypothetical protein PRUPE_ppa000908mg [Prunus persica] Length = 965 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/57 (57%), Positives = 39/57 (68%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 + DR+FL +KIA+CKL+K RR VHKETLVLVWNS + RTVVKERL Sbjct: 909 YGDRHFLSTLKIAKCKLQKGLKVSFVKAPRRRQVHKETLVLVWNSSTVTRTVVKERL 965 >ref|XP_006481823.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X2 [Citrus sinensis] Length = 943 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/58 (58%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARR-NPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRY L VKI +CK + L + EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 886 YADRYSLSTVKITKCKSKNRNLCHNWSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 943 >ref|XP_006481822.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Citrus sinensis] Length = 966 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/58 (58%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARR-NPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRY L VKI +CK + L + EARR + VHKE+LVLVWNS+ L+RTVVKERL Sbjct: 909 YADRYSLSTVKITKCKSKNRNLCHNWSEARRQSSVHKESLVLVWNSKNLIRTVVKERL 966 >ref|XP_004494153.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Cicer arietinum] Length = 981 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/59 (57%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 171 + DRYFL +KIARCK ++ +L +RR VH ETLVLVWNS+ L RTVVKERL Sbjct: 923 YEDRYFLSTLKIARCKSQRCAFNLPVPPPGSRRRSVHLETLVLVWNSKNLTRTVVKERL 981 >ref|XP_004249559.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Solanum lycopersicum] Length = 810 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 F DR FL I+KIARC L++ + PVH ETL+L W+S KL RTVVKERL Sbjct: 754 FPDRNFLCILKIARCNLKRRSFGSTKSGTCTTPVHAETLILTWDSRKLSRTVVKERL 810 >ref|XP_006577063.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like isoform X1 [Glycine max] Length = 979 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 171 ++D+YFL +KIARCK ++ +L R VH ETLVLVWNS L+RTVVKERL Sbjct: 921 YADKYFLSTLKIARCKSQRCAFNLPAPAPGVHRRSVHVETLVLVWNSRDLIRTVVKERL 979 >ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] gi|355500794|gb|AES81997.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] Length = 1039 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDLHNLE--ARRNPVHKETLVLVWNSEKLVRTVVKERL 171 ++DRY L +KIA+CK ++ ++ +RR VH ETLVLVWN E L RTVVKERL Sbjct: 981 YADRYSLSTLKIAKCKSQRCAFNVSVPPPGSRRRSVHVETLVLVWNCENLTRTVVKERL 1039 >gb|ESW34864.1| hypothetical protein PHAVU_001G1880001g [Phaseolus vulgaris] Length = 797 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -1 Query: 341 FSDRYFLIIVKIARCKLRKSTLDL--HNLEARRNPVHKETLVLVWNSEKLVRTVVKERL 171 ++ RY L + IARCK +K +L AR VH ETLVLVWN+ L+RTVVKERL Sbjct: 739 YAGRYSLSTLNIARCKSKKCAFNLPASTSGARSRSVHIETLVLVWNNRDLIRTVVKERL 797 >gb|EXB37743.1| hypothetical protein L484_013781 [Morus notabilis] Length = 1047 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = -1 Query: 314 VKIARCKLRKSTLDLHNLEARRNPVHKETLVLVWNSEKLVRTVVKER 174 VK+ARCK R+ L L LE RR PVHKETLVL W + +++ V KER Sbjct: 934 VKLARCKSRECGLTLPFLEPRRKPVHKETLVLEWTGKNVIKKVAKER 980